KEGG   Porphyrobacter sp. LM 6: BG023_112037Help
Entry
BG023_112037      CDS       T04468                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
porl  Porphyrobacter sp. LM 6
Pathway
porl00071  Fatty acid degradation
porl00072  Synthesis and degradation of ketone bodies
porl00280  Valine, leucine and isoleucine degradation
porl00310  Lysine degradation
porl00362  Benzoate degradation
porl00380  Tryptophan metabolism
porl00620  Pyruvate metabolism
porl00630  Glyoxylate and dicarboxylate metabolism
porl00640  Propanoate metabolism
porl00650  Butanoate metabolism
porl00900  Terpenoid backbone biosynthesis
porl01100  Metabolic pathways
porl01110  Biosynthesis of secondary metabolites
porl01120  Microbial metabolism in diverse environments
porl01130  Biosynthesis of antibiotics
porl01200  Carbon metabolism
porl01212  Fatty acid metabolism
porl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:porl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG023_112037
   00630 Glyoxylate and dicarboxylate metabolism
    BG023_112037
   00640 Propanoate metabolism
    BG023_112037
   00650 Butanoate metabolism
    BG023_112037
  Lipid metabolism
   00071 Fatty acid degradation
    BG023_112037
   00072 Synthesis and degradation of ketone bodies
    BG023_112037
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG023_112037
   00310 Lysine degradation
    BG023_112037
   00380 Tryptophan metabolism
    BG023_112037
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG023_112037
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG023_112037
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BG023_112037
Enzymes [BR:porl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BG023_112037
Exosome [BR:porl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG023_112037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Tex_N ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOL94953
UniProt: A0A1D7NMC9
Position
2093906..2095102
Genome map
AA seq 398 aa AA seqDB search
MTQFAAADPIVILSYARTPMGAMQGALAEVAATDLGAIAVKAAVERAGVSGEDIDRAYIG
CVLPAGLGQAPARQAAIKAGLPLSVQATTVNKVCGSGMQTVIMGAEALASGTIDMVVAGG
MESMTNAPYLLKKHRSGARLGHDTAYDHMFLDGLEDAYEPGRAMGTFAQDTANAYQMTRE
EMDAYSIESLARANRAIASGAFADEVVPVTVSTRAGDVVVEHDEAPSKGRPDKIPQLKPA
FAKDGTITAATSSSISDGAAALVLTRASVAAEKGLTPVARVVATAAHAQAPAQFTTAPIP
AIQKVLARAGWGVDDVDLFEVNEAFACVAMFAMRDLGIPHEKINVNGGGTALGHPIGASG
ARIIVTLIAALKAQGKTRGVASLCIGGGEATAVAVELI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtttgccgccgccgacccgattgtgatcctgtcctacgcacgtaccccgatg
ggcgcgatgcagggcgcgctggccgaggttgcggcgaccgatctcggggcgattgccgtc
aaggctgcggtcgaacgcgccggcgtgtcgggcgaggatatcgaccgcgcctacatcggc
tgcgtgctgccggccgggctcggacaggctccggcgcgccaagcggcgatcaaggccggc
ctgccgctctcggtccaggcaacgaccgtcaacaaggtgtgcggctcgggcatgcagacc
gtcatcatgggggccgaggcgcttgccagcggaacgatcgacatggtggtggccggcggg
atggagagcatgaccaatgccccctacctcctcaagaagcaccgctcgggcgcgcggctg
ggccatgacacggcctatgaccacatgttcctcgacgggctggaagacgcctacgagccg
ggccgcgcgatgggcaccttcgcgcaggacaccgccaacgcctaccagatgacccgcgag
gagatggacgcctattcgatcgaatcgctcgcccgcgccaaccgcgcgattgccagtggg
gcgttcgccgacgaagtcgtgccggtcaccgtttcgacccgtgcgggcgatgtcgtcgtc
gaacatgacgaagcgccctccaaaggccgtccggacaagatcccgcaattgaagcccgcc
ttcgccaaagacgggacgatcaccgctgccacctcaagctcgatctcggacggcgcggca
gccctcgtgctgacccgcgcaagcgtcgccgcagaaaagggcctgacgccggttgcgcgc
gtggtcgccacggctgctcacgctcaggccccggcacagttcaccaccgcgccgatcccg
gcgatccagaaggtgctcgctcgcgccggatggggggttgacgatgtcgatctgttcgaa
gtcaacgaagccttcgcctgcgtcgccatgttcgcgatgcgcgacctcggcattccgcat
gagaagatcaacgtgaacggtggcggcaccgcgcttggtcacccgatcggcgccagcggc
gcgcggatcattgtgacgctgatcgccgccctcaaggcacagggcaagacccgcggcgtc
gccagcctgtgcatcggcggcggggaagcgaccgcagtcgccgtcgaactgatctga

DBGET integrated database retrieval system