KEGG   Porphyrobacter sp. LM 6: BG023_11766Help
Entry
BG023_11766       CDS       T04468                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
porl  Porphyrobacter sp. LM 6
Pathway
porl00071  Fatty acid degradation
porl00072  Synthesis and degradation of ketone bodies
porl00280  Valine, leucine and isoleucine degradation
porl00310  Lysine degradation
porl00362  Benzoate degradation
porl00380  Tryptophan metabolism
porl00620  Pyruvate metabolism
porl00630  Glyoxylate and dicarboxylate metabolism
porl00640  Propanoate metabolism
porl00650  Butanoate metabolism
porl00900  Terpenoid backbone biosynthesis
porl01100  Metabolic pathways
porl01110  Biosynthesis of secondary metabolites
porl01120  Microbial metabolism in diverse environments
porl01130  Biosynthesis of antibiotics
porl01200  Carbon metabolism
porl01212  Fatty acid metabolism
porl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:porl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG023_11766
   00630 Glyoxylate and dicarboxylate metabolism
    BG023_11766
   00640 Propanoate metabolism
    BG023_11766
   00650 Butanoate metabolism
    BG023_11766
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BG023_11766
   00072 Synthesis and degradation of ketone bodies
    BG023_11766
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG023_11766
   00310 Lysine degradation
    BG023_11766
   00380 Tryptophan metabolism
    BG023_11766
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG023_11766
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG023_11766
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BG023_11766
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:porl04147]
    BG023_11766
Enzymes [BR:porl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BG023_11766
Exosome [BR:porl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG023_11766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOL93715
UniProt: A0A1D7NIV1
Position
772764..774032
Genome map
AA seq 422 aa AA seqDB search
MAEAYIIDAVRTPRGIGKQGKGALAACHPQHLAATVLKAIKDRNNLDTKTVDDVIWSVST
QDGMQAGDMGRMAALDAGYDITSSGTTLDRFCGGGITSVALAAAQVMSGMEDCVVAGGTE
MMSLTAAMSQEKMRAGIKPPMMGSYNQRLQKVHPQSHQGICGDAIASKEGFTREELDEVG
YRSQVRAAEAIAEGRFAKSVVPVVADDGTVLLDHEEYPRPQTTMEDLAKLEPAFPKIADV
PLDEAGTTFRKLINQKYPDLEIKHFHHAGNSSGVVDGAAAVLITSKAYAEKHGLKPRARI
VATANMGDDPTLMLNAPVPAAKKVLAKAGLTTEDIDLYEINEAFAVVAAKFVRDLGLSWD
NVNVNGGSIALGHPIGATGSILIGTVVDELERRGGRYGLVTMCAAGGMAPAIIVERVDGF
VD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcttacatcatcgacgctgtccgcaccccgcgcgggatcggcaagcagggc
aagggcgcgctggccgcgtgccacccgcagcatctggccgccacggtgctcaaggcgatc
aaggaccgcaacaacctcgacaccaagaccgtcgatgacgtgatctggtcggtcagcacg
caggacgggatgcaggcgggcgacatgggccgcatggccgcgctcgacgcgggctatgat
atcacctcgtccggcaccacgctcgaccgcttctgcggcggcgggatcaccagcgtcgcg
ctcgccgccgcgcaggtgatgagcggaatggaagattgcgtcgtcgccggcgggacggag
atgatgagcctcaccgccgccatgtcgcaggagaagatgcgcgccgggatcaagccgccg
atgatgggcagctacaaccagcgtctccagaaggtgcacccgcagtcgcaccaggggatt
tgcggcgatgcgattgcctcgaaggaaggcttcacccgcgaagagctcgacgaagtcggc
tatcgctcgcaggtgcgcgcggccgaagccatcgccgaaggccgcttcgccaaatcggtg
gtgccggtggtggctgacgatggcacggtgctgctcgatcacgaggaatatccgcgcccg
cagaccacgatggaagacctcgccaagctggagccggccttccccaagatcgccgacgtt
cctctggacgaggctggcacgaccttccgcaagctgatcaaccagaagtatcccgatctc
gagatcaagcacttccaccacgcgggtaactcctcgggcgtggtcgatggcgccgctgcg
gtgctgatcacctccaaggcctatgccgaaaagcacgggttgaagccgcgcgcgcgcatc
gtcgccaccgccaacatgggcgatgatccgacgctgatgctcaacgcgccggtgccggcg
gcgaagaaggtgctggccaaggctggcctcaccaccgaggacatcgatctttacgagatc
aacgaggctttcgccgtcgtcgccgcaaagttcgtgcgcgacctcgggctgagctgggac
aacgtcaacgtcaacggcggctcgattgcgctgggtcacccgatcggcgcgactggttcg
atcctgatcggcacggtcgtggacgaactcgagcgtcgcggtggccgctatggcctcgtc
accatgtgcgcggcgggcggcatggctccggcgatcatcgtcgagcgcgtcgacggcttc
gtcgactga

DBGET integrated database retrieval system