KEGG   Porphyrobacter sp. LM 6: BG023_11919Help
Entry
BG023_11919       CDS       T04468                                 

Definition
(GenBank) bifunctional NMN adenylyltransferase/nudix hydrolase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
porl  Porphyrobacter sp. LM 6
Pathway
porl00760  Nicotinate and nicotinamide metabolism
porl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:porl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BG023_11919
Enzymes [BR:porl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     BG023_11919
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     BG023_11919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like FAD_syn
Motif
Other DBs
NCBI-ProteinID: AOL93862
UniProt: A0A1D7NJT8
Position
complement(945664..946728)
Genome map
AA seq 354 aa AA seqDB search
MDKIDFGVFIGRFQPLHLGHEHVIARTLDQVERLIVLVGSANVARDPRNPFTYAEREAML
RAAFRHEVAQGRLIIAPLDDHLYSDTAWVAQVQRNVRALVLEHGNGHGFQNHGLADFRVA
LAGYGKDASSYYLKLFPEWESLQVDSQYGTFSSTDVRQRYFQRIPDVPQTILSAGVAEFL
RAFALGETFRGLLEEAEYLAAYPAQWGAGPFVTADAVVVQSGHILLVERGQVPGKGLLAL
PGGFVNPAERIRDAAIRELREETAIGDGKGQIPPAMLASFIEDARTRVFDAPNRSLRGRI
ITHAFLFRLPERRKLFTVKGGDDAAHARWYRLGEISPDMLFEDHWAIIEAMADL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaatcgatttcggcgtcttcatcgggcgcttccagccgctgcatcttgggcac
gagcatgtcatcgcacgcacgctcgatcaggtcgagcggctgatcgtgctggtcggatcg
gccaacgtggcacgcgatccgcgcaaccccttcacctatgccgagcgcgaggcgatgctg
cgggccgccttccggcacgaggtggcgcaaggccggctgatcatcgccccgctcgacgat
cacctctattccgataccgcctgggtggcgcaggtgcagcgcaacgtgcgcgcgctggtg
ctggagcatggcaatggccacggcttccagaaccacggccttgcggatttccgcgtggcg
ctggcaggctatggcaaggatgcctcgtcctattacctcaagctgttccccgaatgggag
agcctccaggtcgacagccagtatggcaccttctcttcgaccgacgtgcgccaacgctat
ttccagcgcatcccggatgtgccgcagacgatcctctcggctggcgtggcggagttcctg
cgcgcgttcgcacttggcgaaacctttcgaggattgcttgaagaggcggaatacctcgcc
gcctatccggcgcagtggggcgcgggaccgttcgtcaccgccgatgcggtggtggtgcag
tcggggcacatcctgctggtcgagcgcggacaggtgccgggcaagggcctgctcgcgctg
cccggcggctttgtgaaccccgccgagcgcatccgcgatgcggcgatccgcgagctgcgc
gaagaaaccgcgatcggcgacggcaagggccagatcccgccagccatgctcgccagcttc
atcgaggatgcgcgcacccgcgtattcgatgccccgaaccgcagcttgcgcggacggatc
atcacccacgccttcctgttccgtctgcccgaacggcggaagctgttcacggtgaaaggc
ggcgatgatgccgcccatgcccgctggtaccggctcggcgagatctcccccgatatgctg
ttcgaggatcactgggcgatcatcgaagcgatggccgacctctga

DBGET integrated database retrieval system