KEGG   Polaromonas sp. SP1: DT070_02765Help
Entry
DT070_02765       CDS       T05689                                 

Definition
(GenBank) carbohydrate kinase family protein
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
pos  Polaromonas sp. SP1
Pathway
pos00230  Purine metabolism
pos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pos00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DT070_02765
Enzymes [BR:pos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     DT070_02765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AYQ27045
UniProt: A0A3G3G6S1
Position
complement(580943..581845)
Genome map
AA seq 300 aa AA seqDB search
MSAVICGSLAFDTIMTFEGRFSEQILPDQLHILNVSFLVPALRREFGGCAGNIAYSLRQL
GGKPLPMATVGTDGAEYVERMKTLGVSTEFVRQVGDTYTAQAMIMTDRDNNQITAFHPGA
MMQAHVTRIEARSDIKLGIIAPDGRDAMLQHAEQFKAAGIPFVFDPGQGLPMFDGKELAH
FVELATWVTVNDYEAKMLCDRTGLSCAELSRRVEGLVVTLGAEGCEVWVAGEKTLVPPVK
ATEVVDPTGCGDAFRGALLFGLEQGWSLARCAALGNRVGALKIATRGGQNYTLTAEQIAA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgttatctgtggctccctggcgtttgacaccatcatgacttttgaggggcgc
ttttccgagcagatcctgcccgaccagttgcacatcctcaatgtgtctttcctggtgccg
gccctgcgccgtgagttcggcggctgcgccggcaacattgcctacagcctgcgccagctc
ggcggcaaaccgctgcccatggccaccgtcggcaccgacggcgccgagtatgtggaacgc
atgaaaaccctgggcgtcagcaccgagttcgtccgccaggtcggcgatacctacaccgcg
caagccatgatcatgaccgaccgcgacaacaaccagatcacggccttccaccccggcgcg
atgatgcaggcccatgtgacccgcatcgaggcccgcagcgacatcaagctgggcatcatt
gctcccgatggccgcgacgcgatgcttcagcacgcagaacagttcaaggcggccggcatt
ccttttgtgtttgacccgggccagggcctgcccatgtttgacggcaaggagctggcgcat
tttgtcgagctggcgacctgggtgacggtcaatgattacgaagccaaaatgctttgcgac
cgcacgggtctgtcgtgcgccgagttgtcgcgcagggtggagggcctggtggtgacgctg
ggcgccgagggctgcgaagtctgggtggccggcgaaaaaacgctggtaccgcctgtgaag
gccacagaagtggtcgatccgaccggctgtggcgatgcctttcgcggcgcactgctgttt
ggcctggagcagggctggtcgctggcgcgttgcgccgcgctgggtaaccgggtgggtgcg
ctcaagatcgccacgcgcggcggccagaattacaccctgactgctgaacaaatcgctgcc
tag

DBGET integrated database retrieval system