KEGG   Polaromonas sp. SP1: DT070_05845Help
Entry
DT070_05845       CDS       T05689                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pos  Polaromonas sp. SP1
Pathway
pos00480  Glutathione metabolism
pos00590  Arachidonic acid metabolism
pos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DT070_05845
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DT070_05845
Enzymes [BR:pos01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DT070_05845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AYQ27593
UniProt: A0A3G3G8E7
Position
1211799..1212293
Genome map
AA seq 164 aa AA seqDB search
MSAEKTVYSFQAKDITGKDVALDAFKGKVMLIVNTASKCGFTPQFAGLEELYKQYAGKGL
AVLGFPSNQFLSQDPGSDDEIAEFCQVNYGVSFPMMSKIDVNGPGAHPLYQWLAAEAPGL
LGIKSIKWNFTKFLVGKDGKVIRRYAPNDKPADLAKDIEAALAA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagaaaaaaccgtttacagcttccaggccaaagacatcaccggcaaagacgtc
gccctggatgccttcaaaggcaaggtgatgctgatcgtcaacaccgccagcaaatgcggc
ttcacgccccagttcgccgggctggaggagctgtacaaacaatacgccggcaaaggcctg
gcggtgctgggctttcccagcaaccagtttctctcgcaagacccgggcagcgacgacgag
atcgccgagttctgccaggtcaactacggcgtgagcttcccgatgatgtccaaaatcgac
gtcaacggccccggcgcgcacccgctgtaccagtggctcgcggccgaagcgcccggcctg
ctcggcatcaagtccatcaagtggaacttcaccaagttcctggtcggcaaagacggcaaa
gtcatacggcgctacgcccccaacgacaagccggccgacctggccaaagacatcgaagcg
gcgctggcagcctga

DBGET integrated database retrieval system