KEGG   Polaromonas sp. SP1: DT070_09770Help
Entry
DT070_09770       CDS       T05689                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
pos  Polaromonas sp. SP1
Pathway
pos00900  Terpenoid backbone biosynthesis
pos01110  Biosynthesis of secondary metabolites
pos01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pos00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DT070_09770
Enzymes [BR:pos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     DT070_09770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AYQ28278
UniProt: A0A3G3GA83
Position
2071584..2072867
Genome map
AA seq 427 aa AA seqDB search
MTVDSRLPNFRALSPSERMAHVGRAAGLSEADLALLAQPGALSVDRANGMIENVVGTFEL
PFGVAGNFTINGKDVLVPMVVEEPSVVAAASFMAKLVRECGGFETSSSEPLMRAQVQVLG
TTDPYGARQALLKRRAEILELANSRDKVLIGLGGGCRDIEVHVFPDTPRGPMVVMHLIVN
VRDAMGANTVNTMAESVSPLVEKITGGTVRLRILSNLADLRLARARLRVTPEALTTKERA
GADVIEGILDAYTLAAIDPYRAATHNKGIMNGIDPVIVATGNDWRAVEAGAHAWACRSGN
YTSLTTWEKDRSGALVGTIEMPMPVGLVGGATKTHPLAQLSLKIMKVETAQELAEVAVAV
GLAQNMGALRALATEGIQRGHMALHARNIALVAGATGDEIDKIARRMASEHDVRTDRAVQ
LLEELRA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgattcccgtcttcccaacttccgtgccttgagcccttctgagcggatggcc
catgtcgggcgcgccgctggcctcagcgaggccgacctggcgttattggcccaacccggc
gccttgagcgtggaccgggccaacggcatgattgagaacgtcgtcggcacttttgaactg
ccctttggcgtggccggcaacttcacgatcaacggcaaggacgtgctggtgcccatggtg
gtcgaggagccctcggtggtggctgccgcatcgttcatggccaagctggtgcgtgaatgc
ggcggtttcgaaacctccagcagcgaacccctgatgcgcgcgcaggtccaggtgctgggc
accaccgatccgtatggtgcgcgccaggctttgctcaagcggcgcgccgagatactcgag
cttgccaacagccgcgacaaggtgctgattggcctgggcggcggttgccgcgacatcgag
gtgcatgttttccccgacacgccgcgcggccccatggtggtgatgcacctcatcgtgaac
gtgcgcgacgccatgggcgccaacaccgtcaacaccatggccgagtcggtctcgccgctg
gttgaaaaaatcaccggcggcacggtccggctgcgtatcctctccaacctggccgatttg
cggctggcccgggcgcgcctgcgtgtgacacctgaggcgttgaccaccaaagagcgcgcg
ggcgccgatgtgatcgagggcatcctcgacgcctatacgctggcggccattgatccttac
cgggccgccacccataacaaaggcatcatgaacggcatcgatcccgtcatcgtcgccacc
ggcaatgactggcgcgcggtcgaggcgggcgcccatgcctgggcttgccgcagcggaaac
tacacgtcgctgaccacctgggaaaaagaccgctccggcgcgctcgtcggcacgatcgag
atgcccatgcccgtgggtcttgtcgggggcgccaccaagacacatccgctcgcacaactt
tcgctgaagatcatgaaggtggaaactgcccaggaactggccgaggtcgctgtggcggtg
ggcctggcgcaaaacatgggtgcgttgcgggcgcttgccaccgaaggcatacagcgcggg
cacatggccctgcacgcccgcaacatcgcactggtggccggcgccaccggcgacgagatc
gacaagatcgccaggcgcatggccagcgaacacgatgtccgcaccgaccgcgccgtccag
ctgctggaggagctccgggcctga

DBGET integrated database retrieval system