KEGG   Polaromonas sp. SP1: DT070_14555Help
Entry
DT070_14555       CDS       T05689                                 

Definition
(GenBank) NUDIX domain-containing protein
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
pos  Polaromonas sp. SP1
Pathway
pos00760  Nicotinate and nicotinamide metabolism
pos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pos00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DT070_14555
Enzymes [BR:pos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     DT070_14555
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     DT070_14555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AYQ29135
UniProt: A0A3G3GCL5
Position
complement(3058666..3059727)
Genome map
AA seq 353 aa AA seqDB search
MTSSPQKHEVSVYIGRFQIFHNGQLALLRRALDAAPLCIVVLGSAWQARTPKNPFTWQER
AEMIRLALPEADRDRIRFLPVRDYYDQDRWVSAVKHGVAELTGGKSGTSPVLIGHFKDAT
SEYLKNFPGWTLDAVPSQGRIDASALRDAYFGNAGAALEPALAALVSQAPASTIAFLRTW
AALPYFLELAQEWESLRLEKAKWAGSPYAPVFVTVDAVVKCGDRVLLIQRGRSPGKGLFA
VPGGFIEQRETVYQSALRELEEETRMRLLDGDMKNALKAVHVFDHPDRSLRGRVITHAHF
FDLGLRQLPEVQAADDAAAAEWIPVDQLAAMEDRFHDDHFHMLDFFFSLTERI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaagcccccaaaaacacgaggtctcggtctacatcggccgcttccagatcttt
cacaacgggcagctcgcgctgctgcgccgggcgctggacgcggccccgctctgcatcgtc
gtgctcggctcggcctggcaggcgcgtacgcccaaaaacccttttacctggcaggagcgc
gcagaaatgatccgcctggcgctgcccgaggcggaccgggaccggatccgttttctgcct
gtgcgtgactactatgaccaggaccgctgggtgtcggcagtcaagcacggtgtggcggaa
ctgacgggcgggaagtccgggacatcccccgtgctcatcgggcatttcaaagatgcgacc
agcgagtacctgaagaactttcccggctggacgctggatgccgtcccatcgcaaggcagg
atcgacgcaagcgctttgcgtgacgcttactttggcaatgccggcgcggcgctggaaccg
gcactcgccgccctggtgagtcaggcgccggccagcaccattgcatttctccgcacctgg
gcggccttgccttacttccttgaactcgcgcaagagtgggaaagcctcaggctggaaaag
gcaaagtgggccggctctccctatgcgccggtttttgtgacggtagatgcggtcgtgaaa
tgcggtgaccgcgtgctgctgatccagcgcgggcgttccccaggcaagggcttgtttgcc
gtgccgggcgggttcatcgagcagcgggaaaccgtataccaatccgctttgcgtgaactg
gaagaagaaacccggatgcgtttgctggatggcgatatgaaaaatgcgctgaaagcggtc
cacgtgtttgaccatccggaccgcagcctgcgcggccgcgtgatcacccatgcccacttc
tttgacctgggcttacgccagttgccggaagtgcaggcggccgacgacgcggccgccgct
gaatggattcccgtggatcaactggccgccatggaggatcgtttccatgacgaccatttc
catatgctggatttcttcttctcgctgacggagcgcatctga

DBGET integrated database retrieval system