KEGG   Porphyrobacter sp. YT40: E2E27_15570Help
Entry
E2E27_15570       CDS       T06153                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
pot  Porphyrobacter sp. YT40
Pathway
pot00471  D-Glutamine and D-glutamate metabolism
pot00550  Peptidoglycan biosynthesis
pot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    E2E27_15570 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    E2E27_15570 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pot01011]
    E2E27_15570 (murD)
Enzymes [BR:pot01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     E2E27_15570 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:pot01011]
 Precursor biosynthesis
  Amino acid ligase
   E2E27_15570 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: QDH35606
UniProt: A0A4Y6VZ18
Position
complement(3296020..3297390)
Genome map
AA seq 456 aa AA seqDB search
MITSPAFAGKRYAVLGLARSGAAAAEALLASGAEVIAWDRQPHAREPFEGRCRMIDPLEL
DLTGFAGVVVSPGVPLNSHPIGPHVWQYGLPVIGDIELFAMARDALPQHKVVGITGTNGK
STTTALVHHILQTAGVPTVMGGNIGDPVLGQEPLPDGGVYVLELSSFQIDLTFTLDCDVA
ALTNITPDHLDRYASFAAYAASKERLFQMQHTGTALICVEDEQTIAIAEGLETSGKLLVR
VKTGDLAAAGLAEGRSPSLAGPHNAQNAAVAVAICRQLGLADAQIAEGLASYRGLPHRME
RVCDAGGVIYINDSKATNAASAAPALAAFPPDPDVNGGAPRIHWIVGGLPKEDGLGACAD
HLGNVAAAYTVGEAGPMFADLLEGQVRVERCELISEAVRRAAEAARPGDVVLLSPACASY
DQFRDYEKRGHHFSQMVRAITGCDAGPDEAGRSILP
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacctcccccgcctttgccggaaaacgctacgcggtgctcggcctcgcgcgctcg
ggcgcggcggcggccgaggccttgctggcgagcggcgcggaggtgatcgcctgggaccgg
cagccccacgcgcgcgagccgttcgaggggcgctgccggatgatcgacccgctggagctc
gatctcaccggctttgcgggcgtggtggtctcgcccggcgtgccgctcaattcgcacccc
atcggcccgcacgtgtggcaatatggcctgcccgtgatcggcgatatcgaactgttcgcg
atggcgcgcgacgcgctgccgcagcacaaggtggtcgggatcaccggcaccaacggcaag
tccaccacaaccgcgctggtgcatcacatcctgcagacggcgggtgtgcccaccgtgatg
ggcggcaatatcggcgatccggttctcgggcaggaaccgctgcccgacggcggcgtctat
gtgctggagctgtcgagcttccagatcgatctcaccttcacgctcgattgtgatgttgcg
gcgctgaccaacatcacgcccgatcatctcgatcgctatgccagctttgccgcttatgcc
gcttccaaggagcggctgttccagatgcagcacaccggcacggcgctgatctgtgtcgag
gacgagcagacgatcgcgattgccgaggggctggaaacctcgggcaagctgctggtgcgg
gttaagaccggcgatctcgctgcggccgggctggccgaggggcgctcgccctcgctcgcc
gggccgcacaatgcccagaacgccgccgtcgcggtggcgatctgccgccagcttggcctt
gccgatgcgcagattgccgaggggctcgcctcctatcgcgggctgccgcaccggatggag
cgcgtgtgcgacgcgggcggggtgatctacatcaacgacagcaaggcaaccaacgccgca
tccgccgccccggcgctcgcggcctttccgcccgatcctgacgtgaacggcggcgcgccc
cggattcactggatcgtcggcggattgcccaaggaagacgggctgggcgcctgcgccgac
catctcggcaatgtcgcggcggcctataccgtgggtgaggcagggccgatgtttgccgac
ctgctcgaagggcaggtcagggtcgagcgctgcgagctgatcagcgaagccgtccgccgc
gccgccgaagctgcgcgtcccggtgacgtcgtgctgctcagcccggcctgcgcctcttac
gaccagttccgcgactacgagaagcgcgggcaccacttcagccagatggtgcgcgcgatc
accggctgcgacgctggcccggacgaggccggtcggagcatcctgccatga

DBGET integrated database retrieval system