KEGG   Paralichthys olivaceus (Japanese flounder): 109623662
Entry
109623662         CDS       T06037                                 

Definition
(RefSeq) arginyl aminopeptidase-like 1
  KO
K09605  arginyl aminopeptidase-like 1 [EC:3.4.11.-]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109623662
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109623662
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109623662
SSDB
Motif
Pfam: Peptidase_M1 Peptidase_M1_N DUF2268 DUF4932
Other DBs
NCBI-GeneID: 109623662
NCBI-ProteinID: XP_019933703
Position
Unknown
AA seq 253 aa
IWWLDSELTCGQSRPLVFTQGHSVCNRSFFPCFDTPAVKSTYTATIRVPDGVTVLMSASR
SSYSKQDRVFQFSMESPVPSYLVALVAGDMQHVDVGPRSRVWAEPCLLSCAVKKLGGSVE
RWLGVAEELFGPYLWGRCDIVFLPPSFPIVAMENPCLTFIIASILESSEFLLIDVIHEIA
HGWFGNAVTNATWEEMWLSEGLATYAQRRITTEAYGEAFTCLETVVRLDALHRQLRLLGD
NNPASKLQIKFEP
NT seq 760 nt   +upstreamnt  +downstreamnt
atctggtggttggactcggagctgacctgtggtcagtctcgtcctctcgtcttcactcag
ggtcactcggtgtgtaaccgctccttcttcccctgcttcgacacgcctgccgttaagagc
acgtacacggctaccatcagggttccagacggcgtcactgtgctgatgagtgcgtcccgg
agttcgtactccaaacaggaccgggtcttccagttctctatggagtctcctgttccgtcc
tacctggtggcgttggtggctggcgacatgcagcacgtggacgtcggtccgaggagtcga
gtgtgggcagaaccatgtctcttgtcctgtgcggtaaagaagctagggggcagtgtggag
cgttggctgggtgtggccgaggagctttttggtccctacctgtggggcaggtgtgacatc
gtattccttcccccctccttccccatcgtcgccatggagaatccctgcctcaccttcatc
atcgcctccatcctggagagcagcgagttccttctgattgacgtcatccatgagatcgca
cacggctggttcggaaacgccgtcaccaacgccacctgggaggagatgtggctgagcgaa
gggttggccacatacgcccagaggaggatcacgaccgaagcgtatggtgaggcgttcacc
tgtctggaaactgttgtgcgattggacgccctccacagacagctgcgtctccttggagac
aacaatcctgcgagcaaactgcagatcaagtttgagccag

DBGET integrated database retrieval system