KEGG   Paralichthys olivaceus (Japanese flounder): 109625216
Entry
109625216         CDS       T06037                                 

Definition
(RefSeq) aminopeptidase Ey-like isoform X1
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00480  Glutathione metabolism
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109625216
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109625216
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109625216
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109625216
   04090 CD molecules [BR:pov04090]
    109625216
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     109625216
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109625216
Membrane trafficking [BR:pov04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    109625216
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   109625216
CD molecules [BR:pov04090]
 Proteins
  109625216
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 Peptidase_M1_N Peptidase_M78
Other DBs
NCBI-GeneID: 109625216
NCBI-ProteinID: XP_019935919
Position
Unknown
AA seq 955 aa
MPEGIREMGKGLYVSKRVAIACAVLAVSAAVTIIALSVSYSKKSETKAVITPEQKVLWQS
YRLPKSLTPLSYNVTLRPRLEPNGYGLYIFTGHSRVVFECVIATNFILIHSKKLNLTTFE
GFHVKLSGLNGGTAPHLKKTWLEVPTQYLVVQLNSFLQVGSKYELYTEFVGELSDELGGF
YRSEYTEDGVKKVVATTQMQATDARKAFPCFDEPAMKAVFHMTLIHPQGTVALSNSRNYD
PVDIVEDGQNLIQTSFKPTAKMSTYLLAFVVSDFTFAGKEPTTGVLIRIWARRKAIKEGQ
GDYALEKTGPILEFFEQYYKIPYPLDKSDQIALPDFNAGAMENWGLITYRETALLYDHDM
SSNGDNEQVASTIAHELAHMWFGNLVTTRWWNDLWLNEGFATYVSYLGANHVEPTWNMLD
LIVLNEVIGAMSVDALASSHPLSSKEEDIMLPEQISELFDSITYSKGGSVLRMLSDFITE
KVFSQGLHTYLEEFKYKNTVYKDLWKHLQMAVDKAGIMLPDSVEAIMNRWILQMGFPVVT
INTKTGKITQKHFLLDPNSVVDRPSVYNYEWFVPVTWIHTGGSKQQHWLITKEATNKDVI
TSADEWLVANIDMKGFYRVNYDSENWERLIAKLSSQHKDIPVINRASIIDDAFNLARANI
VNANLALRTTTFLSKEVEYVPWEAARRNLNYFFLMFDRSEVYGPMQAYLKKQVTPLFNYF
RTLTADWTKIPENHTDQYNQVNAISLACKTGVEACKDLTTSWFKKWMQSPDNNDISPNLR
STVYCNALAEGGEKEWDFAWSMYKKATIASEANKLMHALSCATKPWLLNRYLDYCLDPDK
IRKQDATITIIYISGNPIGQPLAWDFIRAKWSHFFKHGGGSLSFDRLIKGVTTRFSTEFE
YQQLLEFKENNAGKFGSATMALEQVLEKTKANMKWVNMNKKQVFDWFTSEASSPV
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgccagaaggaatacgtgaaatgggaaaaggcttatacgtcagcaaaagggtggcgata
gcctgtgcggttctagccgtcagcgccgcggtcaccatcatagccctgtctgtgtcttat
tctaagaagtctgaaactaaggcagtcatcacgcctgagcagaaggtgctctggcaaagc
tacagacttccaaagtccctcactcctttatcctacaatgtcaccctgaggccccggctg
gagcccaacggttatggcctctacatcttcaccggacactccagagtggtcttcgaatgt
gttattgcgaccaacttcatccttatccactccaagaagttaaacctcaccacctttgag
gggttccatgtcaaactgagtggcctaaatggaggcactgcaccacacctgaagaaaacc
tggctggaggtccccacccagtacctggtggtccagctcaacagctttctgcaggtcggc
agcaagtacgagctctacactgagtttgttggagagctgtccgatgagctgggaggattc
tacaggagtgaatacacagaagatggagtgaaaaaagttgtggccacaactcaaatgcag
gcaacagatgccaggaaagccttcccctgcttcgatgagccggctatgaaagctgtcttc
cacatgactctcattcacccccaggggaccgtggctctgtccaactccaggaactacgac
cctgtagacattgttgaagatggccagaatttaatccagaccagtttcaaacccacagca
aaaatgtcaacctatttgcttgcttttgttgtgagtgattttactttcgctgggaaggaa
ccgactacaggcgtcttgatcagaatctgggctcgcaggaaggccataaaagagggacag
ggcgactatgccctcgagaagactgggcccatactggaattctttgagcagtactacaaa
atcccctaccctctggacaaatcagatcagattgctcttcctgattttaatgctggagct
atggagaactggggcttgatcacctacagagagacagccctcttgtatgatcatgacatg
tcctccaatggagacaacgagcaggtggcatccaccatcgcccatgagctcgctcatatg
tggtttggaaacttggtgaccacgaggtggtggaatgacttatggctcaacgagggattt
gcaacctatgtttcttatcttggagccaaccatgttgaaccaacgtggaatatgcttgat
ttaatagtcctgaatgaggtcattggtgccatgtctgtggatgctctggcctcctcccat
ccactttcatccaaagaggaggacatcatgttgccagagcagatcagtgaactgtttgac
tccatcacatacagcaagggaggttcagtcctcaggatgctctcagattttatcactgag
aaggtcttctcccaaggtctccatacatacttagaggagttcaagtacaaaaacacagtc
tacaaagacctctggaagcatctccaaatggcagtggataaagctggtataatgctgcct
gactctgtggaggctatcatgaaccgatggatcctacagatggggttccctgtggtcacc
atcaacaccaaaactggaaagatcactcagaaacacttcctgctggatccaaactctgtt
gtggacagaccttcagtgtacaattacgagtggtttgtccctgttacatggattcacact
ggtggatctaaacaacagcactggcttattaccaaagaagccacaaacaaggatgtgatc
accagtgctgatgagtggttggtggccaacatagatatgaagggtttctacagggtcaac
tatgactctgagaactgggagcgtctcatcgcaaagttgagctctcaacataaggatatt
ccagtgatcaaccgggcctcgattattgatgatgcttttaatcttgcaagggcaaatatt
gtaaatgcaaatttggctctgaggacgaccacgttcctcagtaaagaagtagaatacgtg
ccatgggaggcagccaggcgcaacttgaactacttcttcctcatgtttgatcgcagtgaa
gtttatggacccatgcaggcttacctaaagaaacaggtcactcctctgtttaactacttc
agaactctcactgccgactggacaaagatccctgaaaatcacactgaccagtacaatcag
gtgaatgccatctccttggcctgcaagactggggtggaagcctgtaaggatctgaccact
agctggttcaaaaagtggatgcaaagccctgataacaatgacattagtcccaacttgagg
tccacagtgtactgcaatgcactagcagaaggaggagagaaggagtgggactttgcttgg
tccatgtacaagaaagctacaatcgcctctgaagctaataaactcatgcatgctctgtct
tgtgccacaaagccatggctgctcaataggtatctggactattgtttggacccagacaag
atccgtaagcaggatgccaccattaccattatttacatctctggaaaccccatcggacag
cctctggcttgggactttatcagagccaaatggagccactttttcaagcatggcggtgga
tcactttcttttgatagactaattaaaggagtgaccacacgtttctccactgagtttgaa
tatcagcagctgctggagttcaaagaaaacaatgcagggaagtttggctcggccaccatg
gctttggagcaggtgttggagaaaaccaaggccaacatgaagtgggtgaacatgaacaag
aagcaggtgtttgactggttcaccagtgaagcctcttccccagtttag

DBGET integrated database retrieval system