KEGG   Paralichthys olivaceus (Japanese flounder): 109625593Help
Entry
109625593         CDS       T06037                                 

Gene name
gpx3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00480  Glutathione metabolism
pov00590  Arachidonic acid metabolism
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109625593 (gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109625593 (gpx3)
Enzymes [BR:pov01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     109625593 (gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 109625593
NCBI-ProteinID: XP_019936433
Position
Unknown
AA seq 221 aa AA seqDB search
MFPFLQLLLLLGLLRPHTAGAALTQRCDSSMDDTIYKYQAKTLNGSHTVNFSHYSGRSVL
FVNVATYUGLTFQYVELNALQEEMKEFGLTVLGFPCNQFGKQEPGQKHEILPGLKHVRPG
NGFMPNFLLFDKGDVNGKDEQEVYTFLKKSCPPVGDDFGNPANRLFWDPLKISDIKWNFE
KFLVDPEGKPVMRWHPSVNVSAVRADIRKYLLQRYTRDQFN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccttcctgcagctgctgctgctgctcggtcttctgcggccccacaccgccgga
gccgcgctcacacagcgttgtgactcatccatggatgacaccatttacaaataccaggca
aagaccctaaacgggagccacactgtaaacttcagccactacagcggcaggagcgttctg
ttcgtcaacgtggcgacatactgaggtctcacctttcagtatgtggaactgaatgcacta
caggaggagatgaaagaatttggactcaccgttcttggatttccctgcaatcagtttggg
aaacaggaacctggacaaaaacatgagatcctgccaggtttaaaacatgtcagaccaggc
aacggattcatgccaaacttcctgctgttcgacaagggggatgtgaacggaaaagacgag
caagaggtttacacattcctgaagaaatcctgcccaccagttggagatgacttcggtaac
cctgccaacagattgttctgggaccctctgaagatcagcgacatcaagtggaactttgag
aagttcctggtggacccagaggggaagcctgtgatgaggtggcacccaagcgtcaacgtt
tctgcggtccgagccgatatccgcaaatacctgctccaacgctacacccgggaccaattt
aattag

DBGET integrated database retrieval system