KEGG   Paralichthys olivaceus (Japanese flounder): 109626746Help
Entry
109626746         CDS       T06037                                 

Definition
(RefSeq) nucleoside diphosphate kinase A2-like
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00230  Purine metabolism
pov00240  Pyrimidine metabolism
pov00983  Drug metabolism - other enzymes
pov01100  Metabolic pathways
Module
pov_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pov_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pov_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109626746
   00240 Pyrimidine metabolism
    109626746
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109626746
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109626746
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     109626746
Membrane trafficking [BR:pov04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    109626746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 109626746
NCBI-ProteinID: XP_019938450
Position
Unknown
AA seq 152 aa AA seqDB search
MAELKERTFIAIKPDGVQRGIIGDIIKRFEAKGFKLVGMKFVHASEDLLNQHYADLKDRP
FFPTLIKYMRSGPVVAMAWEGKGAVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHG
SDSVESANKEIALWFKDDELVSYTSCAFSWLY
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcttaaggagcgcacctttattgccatcaagcccgatggtgtacagaggggc
atcattggagatatcatcaagaggtttgaggcaaagggcttcaaactcgtgggcatgaag
ttcgtccatgcctctgaggacctcctgaaccagcactatgctgacctgaaggacagacct
ttctttcctaccctcatcaaatacatgcgctctggaccagtggttgccatggcatgggaa
ggcaaaggtgcagtgaagactggcagggtgatgctcggtgagaccaaccccgctgactcc
aagcccggaaccatcagaggagacttctgcatcgacgtcagcaagaacattatccatggc
agtgactcagtggagagtgccaacaaggagatcgccctgtggttcaaagatgacgagctg
gtcagctacactagctgtgccttcagctggctctactaa

DBGET integrated database retrieval system