KEGG   Paralichthys olivaceus (Japanese flounder): 109627831
Entry
109627831         CDS       T06037                                 

Gene name
enpep
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109627831 (enpep)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109627831 (enpep)
   04090 CD molecules [BR:pov04090]
    109627831 (enpep)
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     109627831 (enpep)
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109627831 (enpep)
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109627831 (enpep)
CD molecules [BR:pov04090]
 Proteins
  109627831 (enpep)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF5022 DUF1570 Aminopep
Other DBs
NCBI-GeneID: 109627831
NCBI-ProteinID: XP_019940201
Position
Unknown
AA seq 959 aa
MVESMDFEKQQKRYCIRGKHAVIICVTIVACSLAVGLGVGLSRSDTTTNPTSTPGPTAKP
TQPPLPVRGPCTPSVDSSGDWRNFRLPNYVNPVHYDLNLEPNMEEDTYMGTVDIHVEVSK
PTRHLWLHIRETFVSAMPRLKMLDSQGGQRELPVKSCFEYKPQQYVVVEVAEPLPVTATG
EVYVLSLDFQGWLNGSVVGFYRVIYTEEGLTKKIAATDHEPTDARKSFPCFDEPNKKATY
NISIVHDANYEALSNMPLQGLPQQLPRNKLKTSFQKSVPMSTYLVCFAVHQFGHVERTSA
GGIPLRIYAQKTQLRTAEYAANTTKVIFDYFEDYFNMTYSISKLDKIAIPDFGTGAMENW
GLITYRETNLLYDENQSSSYNKQRVASVIAHELVHQWFGNIVTMDWWDDLWLNEGFASFF
EYIGVERAEPSWGMRDIMIISDVLPVMVDDALLSSHPIIVNVSTPAEITSVFDGISYSKG
ASILRMLEDWMGKDKFRDGCRKYLKDYHFKNAKTANFWASLAAVSSLPVAEVMDTWTNQM
GYPVLDLSVSEMNTSLSQRRFLLDPNANSSMPPSPLEYKWTIPVKWHSVKSEKNVLAMFN
KSSNEHVISNYTPSVDGLLKVNNDHIGFYRVNHDVQMWNMISEQLRTNHMEFDAADRTSY
IDDVFALARADIIDYGNAFNLTMYLTKEIDYIVWERVATSISYVRDMLIADAALYTKFQK
LFRDHVRAISQRLGWKDEGTQTERLLRETVLSIACQMGDQDALNEASSIFDRWINGSLSS
VAVNLRLLVYRYGMKNSGTEAKWNTMFQRYKETSLAQEKDKLLYGLSSVDNVELLYKLLE
ATKNESVIRSQDLFTVVRYVSINPLGEGMAWDWTTLNWDYLVNRYTINDRNLGRLLSRIT
TNYNTELLLWKMEHFFSLTPDAGAGVMPRQQALERVRNNIEWIRRNGNEIRGWLDNNVA
NT seq 2880 nt   +upstreamnt  +downstreamnt
atggttgaaagcatggactttgagaagcaacagaagcgttactgcatccgtggtaagcat
gcagtcatcatctgtgtgacgattgtggcgtgctctctggcggtgggtcttggggtgggc
ctctccaggtcagatacaaccaccaatcccacctccacgccaggccccacagcaaagcct
acacagccccccttgcctgtgagagggccttgcacaccttccgttgattcttctggggac
tggaggaatttccgcctccctaactacgtgaacccggtccactatgacctgaatctggaa
ccaaatatggaagaggacacctacatgggcactgtggacatccatgtagaagtcagcaag
cccacccgccacctgtggctccacatccgagagacgtttgtcagtgccatgcctaggctg
aagatgctggacagccaggggggccagagggagctgccagtgaaaagctgttttgaatac
aaaccgcagcaatatgtggtggtggaggtcgcagagccactgccagtcaccgccacagga
gaggtgtacgtgctgagtttggacttccagggctggcttaacggctctgtggtgggattc
tacagggtcatctacaccgaggaggggctcaccaaaaagattgctgcaactgatcatgag
ccaacagatgcccgcaagtcctttccctgcttcgatgaacccaacaagaaggccacatac
aacatctccatcgttcatgatgcaaactatgaggctctgtccaacatgccgctgcagggc
ctccctcaacaactgcctcgtaataaactgaagacctccttccagaagtccgtccccatg
agtacctacttggtatgtttcgcggtgcaccagtttggccatgtggaacgaacctctgct
ggaggaattcctctgagaatctacgctcagaagactcagttgagaactgcagagtacgca
gccaacacgaccaaggtcatctttgattactttgaggattatttcaacatgacatactcc
atctcaaaactggataagatagccatccctgactttggcacgggtgccatggagaactgg
ggcctcatcacctacagggagacaaacctcctgtatgatgagaaccagtcgtcctcctac
aacaagcagcgagtggccagtgttatcgcccatgagctggttcaccagtggtttgggaac
attgtgaccatggactggtgggacgacctgtggctcaatgagggcttcgccagtttcttt
gagtacatcggtgtggaaagagctgaaccttcctggggcatgcgagacatcatgatcatc
agcgatgtgcttccagtgatggtggacgacgccctcctctcctctcatccaatcattgtg
aacgtgtcgaccccagcagagatcacctccgtgtttgatggcatctcatacagcaaggga
gcgtccatcctcaggatgctggaggactggatgggtaaagataagttcagagacggctgt
cgaaaatatttgaaagactaccacttcaagaatgccaagacagccaacttctgggcgtct
ctcgccgctgtgagtagcttgccagttgcagaggtcatggacacatggaccaatcagatg
ggttatcctgtgctggatctgtctgtctcagagatgaatacaagtctgagccagaggcgt
ttcctcctcgatcctaatgctaactccagcatgcctccttcacctctggagtacaagtgg
accatcccagtgaaatggcactctgtgaaaagtgaaaagaatgtgttggcaatgtttaac
aagagcagcaacgagcacgtcataagtaactacacaccctcagtggacggtctgcttaag
gtgaacaatgatcacattggattctacagagtcaaccatgacgtccagatgtggaacatg
atcagcgaacaacttcgaaccaaccatatggaatttgatgcagctgatcgaacgagctac
attgatgatgtctttgcacttgcaagggctgatattatagactatggtaatgccttcaat
ctgaccatgtacctgacgaaagagattgattacatagtgtgggaacgtgtggctacctcc
atctcgtatgtgagggacatgctgatagccgatgctgctctctacacaaagttccagaaa
ctctttcgagatcacgtcagagcgatctcccaacgacttggatggaaagatgaaggaact
cagacagagaggttactgagggagaccgtgctcagtattgcttgtcagatgggagatcag
gatgctctgaatgaagcctccagtatttttgaccgctggattaatggaagtctcagtagt
gtcgcagtaaacctgaggctgctggtctatcgatatggaatgaagaactcgggcacagaa
gcaaagtggaacacgatgttccagaggtacaaagaaacgtctttggctcaagagaaggac
aagctgctgtatggactgtcgtctgtggacaacgtggaacttctgtacaagctcctggag
gccactaagaatgagtctgtgattaggagtcaggatctgttcaccgtggtgcgatatgtg
tctatcaacccactgggagagggtatggcctgggactggaccacactgaactgggactac
ctggtcaacaggtacaccatcaacgacaggaacctcggtcgtctactcagtcgaatcacc
accaactacaacacagagctgctgttgtggaagatggagcatttcttcagtctaacaccg
gatgctggtgcgggggtgatgcccaggcaacaggcactggagagagtgaggaacaacatc
gaatggatcaggaggaacgggaatgagatcagagggtggctggacaacaatgtggcctag

DBGET integrated database retrieval system