KEGG   Paralichthys olivaceus (Japanese flounder): 109628461
Entry
109628461         CDS       T06037                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00100  Steroid biosynthesis
pov01100  Metabolic pathways
Module
pov_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109628461 (tm7sf2)
Enzymes [BR:pov01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109628461 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 109628461
NCBI-ProteinID: XP_019941117
Position
Unknown
AA seq 444 aa
MTELLLFYLQLHVTHRSPMMRPNNQASKHRSSHDTEREFGGTLGALCIPIFLPLTVLFLI
CMSRSPEASVFQWPPLLPSSDELWDPLAPLLLLGWIALHALLYLMPLGKVSEGLVLRDGT
RLKYPINGFHGLCVSGVLLMLFLGLGAPLGHLFELLLPLAVSAVAMSFLLSVYLYIRSFW
EPSHALALGGNTGNPLYDFFIGRELNPRIGDFDLKYFCELRPGLIGWVVINLGMLMKEVE
LRGSPSLAMLLVNSFQLLYVSDALWNEEAVLTTMDIVHDGFGFMLVFGDLCWVPFTYGLQ
AAFLVVHPQTLSWFKAAVIIALNGIGYYIFRKSNSQKNQFRRDPTHPSVARLETIATATG
KRLLVSGWWGLVRHPNYLGDLLMALAWSLPCGFSHLLPYFYVIYFTVLLIHREDRDERQC
RTKYGLAWDTYCHRVPYRIFPYIY
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgacagagttactactcttctacctgcagctccacgttactcaccggagtccaatgatg
aggcccaacaatcaagcatccaaacacagatcctcacatgacacagagagggaatttgga
ggaaccctgggtgctttatgcattcccatctttcttccattgacggtgctgttcctgatc
tgtatgagtcgatcccccgaagcctctgtcttccaatggcctcctctgctcccctccagt
gacgagctgtgggaccctctggcccccctgcttctgctgggatggatcgctctgcatgcc
ctcctctacttgatgccattaggaaaggtgtctgaaggattagtgctgagggatggaaca
cgcctcaagtatcccataaatggttttcatggcctgtgcgtcagcggcgtgttgctgatg
ttgtttctggggctcggggctcctcttgggcatctgttcgagctgctgttgcctctggca
gtgagcgcagtagccatgtccttcctgctctccgtctacctctacatccgctccttttgg
gagccttcccatgctctcgctttggggggcaacacaggaaatcccttgtatgatttcttc
atcggacgggagttaaatcctcggatcggagactttgaccttaaatatttctgtgagctc
agaccagggctgattggctgggtcgtcattaacctgggcatgctgatgaaggaggtggag
cttcgagggtccccctccctcgccatgttactggtcaacagtttccagctcctgtatgtg
tcggacgctctgtggaatgaggaggctgtcctgacaaccatggacattgtgcatgatggt
tttggcttcatgctggtgtttggagatctgtgctgggttcccttcacatacggcctgcag
gcagccttcctggtcgtgcacccacagaccctgagttggtttaaagccgcagttataata
gcactgaatggtattggatattatattttcagaaaatccaactcgcagaagaaccagttc
agacgagaccctacacatccaagtgttgcaagactggagaccatcgccacggcaacaggg
aagcggctgctggtgtccggttggtggggtctcgttcgtcatcccaattaccttggtgac
ctcctcatggccctggcgtggtccctgccatgtggattctcacatctgctgccttacttc
tacgtcatatatttcaccgtgctgctgatccaccgagaggaccgggacgagagacagtgc
cggaccaaatatggactagcgtgggacacctactgtcaccgcgtcccctacaggatcttc
ccctatatctactga

DBGET integrated database retrieval system