KEGG   Paralichthys olivaceus (Japanese flounder): 109628762
Entry
109628762         CDS       T06037                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04080  Neuroactive ligand-receptor interaction
pov04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109628762 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109628762 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 109628762
NCBI-ProteinID: XP_019941667
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLLVSLLCSATAGPMASVEHGRELEEASTVRKMVQQSPARGGQTHRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgct
actgctggtcccatggcctccgtggagcatggcagagagctggaagaggcctctacagtg
agaaaaatggtccaacaaagccctgcaaggggtggtcagacccacagaccagccggctgg
aagaggagacgcccacggccccgtctttcccacaaggggcccatgccattctag

DBGET integrated database retrieval system