KEGG   Paralichthys olivaceus (Japanese flounder): 109629620
Entry
109629620         CDS       T06037                                 

Definition
(RefSeq) uncharacterized protein LOC109629620
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pov03000]
    109629620
Transcription factors [BR:pov03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109629620
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 109629620
NCBI-ProteinID: XP_019942948
Position
Unknown
AA seq 694 aa
MTMIPPGDCMYAGRKRRKPIQKQKPSSSNEKTNPSKRHRDRLNAELDRLASLLPFPPDVI
SKLDKLSVLRLAVSYLRVKSFFQANQEKPSRKHIISPASSNPEPRKDSLPLGNINESSLL
LESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAM
CPPQHQGTSAHQDTQLGAGTGEDFVVSSQFNSLEAGGIPPELSCFLNRCFIARVRCLLDS
TSGFLTMQFQGRLKFLHGQKKKSASGALMPPQLALFCIGVPLLLPSITEMKMKNMLMRGK
NKGGGGISAMEHGERGEHLRRHSFSGGMGDIADPLLLSCPTPGGTQRGHQTPWTPLSKDN
VKYRPDGYYNQEEPLNYCKSSMASHKGLSPGLGAGWPLRPNSGPIRGGQGVGYVPSNRLN
KAGHYGKPYRLSPNFHSNRGGEVFVSKLYGNIQIPTDPDAYCVDLVKSENGYGECYDGHL
MTEMPPIKVEHDSDSENGCDAYGRPWACRDPEAIDRRYGNGMYDQSSGLPLKSEADYYDP
QFSPCQRGKAGISPPYNNGNYQNYAVNNGGNTNARLLKCDKDLGSNNDNNQFSPQRLSHS
DSLCSNQSVNLMDSHVYPQDQHKAYMHPDYNKHGSYEFKGHGLIHSIKREPMDSPPWSDG
GHDMNQSMMVGPRNVMPCVMSAGHHKSSPYIYMP
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgaccatgatccctccgggagactgcatgtacgcgggcagaaagaggaggaagcccatc
caaaaacagaagccgtcctcgagcaacgagaaaaccaacccgtccaagcggcaccgggac
aggctgaatgccgagctggaccggctggccagcctgctgccgtttcccccggatgtcatc
tccaagctggacaagctgtctgtgctgcgcctcgcagtttcctacctccgcgtcaaaagt
ttcttccaagcaaaccaagagaagccctccaggaagcacatcatcagcccagcatcctct
aaccctgaacccaggaaagatagtcttccattgggcaacatcaatgaaagcagcctcctc
ctggaatctctgacagggttcgccttggtggtgagcagtgatgggatggtcttttacgcc
tcctcaaccattgtggattatctgggatttcatcagactgatgtgatgcaccagaatgtg
tttgactacatccacattgacgaccgtcaggagtttagacgccagctccactgggccatg
tgtcctccgcagcaccaggggacatcagcacaccaggacacccaactgggtgcagggact
ggtgaggactttgtggtcagcagtcagtttaactctctggaggccgggggaattcctcct
gagctctcctgcttcctaaacagatgtttcattgccagagtccgatgcctcttggacagc
acctctggattcttgacaatgcagttccagggtcgactgaagtttctccatgggcagaaa
aagaagtcagcctccggggccctgatgcctccccagctggctctgttctgcattggtgta
ccactgctactgccctccatcaccgagatgaaaatgaagaacatgttaatgcggggaaag
aacaagggaggaggaggtatctctgcaatggagcatggcgagcgaggggaacacctccgc
agacactccttcagtggagggatgggcgacattgcagaccctctcctcctctcgtgtccc
actcctggtggcacccagcgaggtcaccaaactccctggaccccgctctccaaagacaat
gtcaagtaccgccccgatggctactacaaccaggaggagcccctcaactactgcaagtcc
tccatggcctcccacaaaggtctcagcccgggcctgggtgccggctggcccctgcggcca
aactcgggccccatcagagggggccagggtgttggctatgtcccatctaaccgcttaaac
aaagccggtcattacgggaagccgtaccgcctttccccaaatttccacagcaacagaggt
ggtgaggttttcgtgtccaagctctatgggaacatccagattccgacagacccagatgct
tactgcgtggacctggtgaagagcgagaatggctacggagaatgctacgatggccatctg
atgaccgagatgcctcccatcaaggtggagcacgactcagactctgaaaacggctgtgac
gcctatggccgaccctgggcctgccgcgacccagaggccattgatcgtcgctatggtaac
gggatgtacgaccagagctctgggctgccactcaaatcagaggctgattattatgatcca
cagttctcgccctgtcagcgagggaaggcaggaatcagcccgccatacaacaacggcaac
tatcaaaactatgcagttaacaacggtgggaacaccaacgcacgtctgctgaagtgcgac
aaagacttgggaagcaacaatgacaacaaccagtttagtcctcagagactctctcattct
gactctctatgcagcaaccagtctgtcaacctcatggactcgcacgtctacccgcaggac
cagcacaaagcctacatgcacccagactacaacaagcacggttcctacgagttcaaaggt
catggcctgatccactccatcaagcgggaacccatggactccccgccgtggtctgacggc
ggccatgatatgaaccagtccatgatggtcggtccaaggaacgttatgccatgtgtgatg
agcgcagggcaccacaagtccagtccttacatttacatgccgtaa

DBGET integrated database retrieval system