KEGG   Paralichthys olivaceus (Japanese flounder): 109631203Help
Entry
109631203         CDS       T06037                                 

Definition
(RefSeq) histamine N-methyltransferase A-like
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00340  Histidine metabolism
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    109631203
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109631203
Enzymes [BR:pov01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     109631203
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109631203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_31 Methyltransf_12 Methyltransf_16 Methyltransf_11 Methyltransf_28 DUF1073
Motif
Other DBs
NCBI-GeneID: 109631203
NCBI-ProteinID: XP_019945379
Position
Unknown
AA seq 290 aa AA seqDB search
MAAEAKQTCYEGSAVQSFKFYLEQSGEHEAIVRGIHSLLPAEFKRIGEGRSGLDVLGVGS
GGGEVDVQMLSLLQSTFPAVPITADIVEGSGELTDNFKALVAKTTNLQKVPFAWHVMHSE
DYEKQVKAKGNMKKFDFIHMIQMLYYVNNLADTIKFYHNLLKNNGTLMIIIETAHAGWDT
LWKTYKKELCVDAITEYRSSAEVIACLKSQGLKYEEHIIHNTFDITECYDPNSTTGARMM
NYMTAKENFHQSFSQEVRAGILDLLKNKCSTVKDGRVLFNSNTSCILVHA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaagcaaagcagacttgttacgagggcagtgcggtgcaaagcttcaagttc
tacctggaacagtctggagaacatgaggccattgtgcggggcatccacagcctcctgcca
gcagagtttaaaagaattggagaaggtagaagtggtcttgatgttctgggcgttggaagt
ggtggaggggaggtggacgtccagatgctctctctgctgcagtcgacattccccgctgtt
cccatcaccgctgacattgtggagggcagtggcgagctcacagataactttaaagctttg
gtagcaaagaccaccaacctccagaaggtcccgtttgcttggcacgtcatgcacagtgag
gactatgagaagcaagtgaaagcaaagggaaacatgaaaaagtttgacttcatacacatg
atccagatgctctactatgtgaataacctcgctgacactatcaagttctaccacaacctt
ctgaaaaacaacggcacgctcatgatcatcattgaaacagcccacgcaggctgggacacc
ctgtggaagacgtacaagaaggagctctgtgtggacgccatcacagagtaccgctcgtca
gcagaggtgatcgcctgtctgaagagccagggtctgaagtacgaggagcacatcattcac
aacaccttcgacatcactgagtgctacgatcctaatagcaccacaggagcacgtatgatg
aattacatgacagccaaagaaaacttccatcagtccttctcccaggaggtcagagctgga
atcttagacctcctcaagaacaagtgcagcacggtgaaagacggccgggtgttgttcaac
agcaacaccagctgcattctggttcatgcctga

DBGET integrated database retrieval system