KEGG   Paralichthys olivaceus (Japanese flounder): 109631969Help
Entry
109631969         CDS       T06037                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04060  Cytokine-cytokine receptor interaction
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04218  Cellular senescence
pov04350  TGF-beta signaling pathway
pov04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109631969 (tgfb2)
   04350 TGF-beta signaling pathway
    109631969 (tgfb2)
   04068 FoxO signaling pathway
    109631969 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109631969 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109631969 (tgfb2)
   04218 Cellular senescence
    109631969 (tgfb2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109631969 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pov04052]
    109631969 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:pov00536]
    109631969 (tgfb2)
Cytokines and growth factors [BR:pov04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109631969 (tgfb2)
Glycosaminoglycan binding proteins [BR:pov00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   109631969 (tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 109631969
NCBI-ProteinID: XP_019946614
Position
Unknown
AA seq 413 aa AA seqDB search
MNLCIVSLLLTLDLATVALSLSTCSTLDMDQFKKKRIEAIRGQILSKLKLTSPPVDFPEP
EEVSRDIVAIYNSTRDLLQEKANDRAATCERQRSEEEYYAKEVHKIDMYPFYPSENVISA
THFNPYFRRLTFDVSSMEKNASNLVKAELRIFRLQNPVARVSEQRIELYQILGHKDLTSP
TQRYIDSKVVRTQTEGEWLSFDVTEAVSEWLNHRDRNNGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDSFIHGGDLKVFKRRRHSARAPHLLLMLLPSYRLESQSRHKNHRSK
RALDAAYCSKNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYEANFCAGACPYLWSADTQHS
KVLGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMKVKSCKCS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtgtatcgtcagtcttctgctcactttggatttagccactgtggcgctcagt
ttgtccacatgcagcacgctggacatggatcagttcaagaagaagcgcatcgaggcaatt
cgagggcagatcctgagcaagctgaagctcaccagccccccggtggacttccccgagccc
gaggaggtgtcccgggacattgtggccatatacaacagcaccagggacctgctgcaggag
aaagccaacgatcgggcggcgacgtgcgagcggcagcgcagcgaggaggagtattacgcc
aaggaggtgcacaagatcgacatgtatcccttctacccgtcagagaatgtcatctctgca
actcatttcaacccttacttcagacggctgacatttgatgtttcctctatggagaagaat
gcatccaacctggtgaaggctgagctcaggatcttccgtcttcaaaaccctgtggccaga
gtgtctgagcaacgcatcgagctctaccagattttaggacacaaagatctgacttcccct
acacagcggtatattgacagcaaggtggtacgaacacaaacagagggagagtggctgtct
tttgatgtcacagaggcagtgagtgaatggttgaaccacagagacagaaacaatggattc
aagatcagcctgcactgcccctgctgcacatttgtaccatcaaataactacattattccc
aacaagagtgaagaattggaggcacggtttgcaggtattgatgacagcttcattcatggt
ggtgacctaaaggtatttaagaggcggcgtcacagtgctcgggctccacaccttctcctc
atgcttctcccttcataccggctggagtcccagtcccggcacaagaaccatagatccaag
agggccctggatgctgcctactgctccaaaaatgtgcaggacaactgctgcttgcgttca
ctctacatcgattttaagaaggacctgggctggaggtggatccatgagccaaagggatat
gaggccaacttctgtgccggggcatgtccatatctatggagtgctgacacgcagcattcc
aaggtattaggcctttataacaccatcaaccctgaagcatcagcgtcaccctgctgcgtc
tcccaggacctggagcccctcaccatcctctactacataggcaagactcccaaaatagaa
cagctctccaatatgaaggtcaagtcctgcaagtgcagctag

DBGET integrated database retrieval system