KEGG   Paralichthys olivaceus (Japanese flounder): 109632186
Entry
109632186         CDS       T06037                                 

Gene name
taf2
Definition
(RefSeq) transcription initiation factor TFIID subunit 2
  KO
K03128  transcription initiation factor TFIID subunit 2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    109632186 (taf2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109632186 (taf2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pov03021]
    109632186 (taf2)
   03036 Chromosome and associated proteins [BR:pov03036]
    109632186 (taf2)
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109632186 (taf2)
Transcription machinery [BR:pov03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     109632186 (taf2)
   Coactivators
    SAGA/TFTC/STAGA complex
     109632186 (taf2)
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     109632186 (taf2)
SSDB
Motif
Pfam: HEAT_2 Peptidase_M1_N Peptidase_M1 IL2 SR-25
Other DBs
NCBI-GeneID: 109632186
NCBI-ProteinID: XP_019946909
Position
Unknown
AA seq 1211 aa
MNRKKDKGFESPRPFKLTHQMVCINNINFQRKSVIGYVELTIFPTVVNLNRIKLNSKQCR
IYRVRVNELEAPFIYNDPTLEVCHHESKQRNLNYFSSAYTAAVSAVDPDAGHGELVIKVP
SELWKQGDDLKVLKVYIEFSLDQPKGGLHFVVPDVEGSMAERGAHVFSFGYQNSTRFWFP
CVDSYSELCTWKLEFTVDASMVAVSCGDLVETIYTHDMRKKTFHYVLPIPTASPNISLAV
GPFEILVDPYMHEVTHFCLPQLLPLLKHSMSYLHEIFEFYEEILTCRYPYSCFKTVFVDE
SYVQVSSYASMSIFSTNLLHSAMIIDQTPQTRRCLAQALAQQFFGCFISRMSWADEWVLK
GISGYIYGLYLKKTFGVNEYRHWIKEELDRIVDYELKMGGVLLHPTFSGGKEKDNPTPHL
HFSIKHPHTLSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKYQSH
MWSQMLLSTHAFLKSISNVSGKDIGPLIKQWVDQSAVVKFFGSFAFNRKRNVLELEIRQD
YTSSGTQKYVGPIKVTVQELDGSFKHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEE
VDMDLSAMDADSPLLWIRIDPDMSILRKVEFEQADFMWQYQLRYERDVVAQEESISALEK
FPTPASRLALTDILEQEQCFYKVRMQACFCLARIANSMVSTWQGPPAMKSLFTRMFCCKS
CPNIVKTNNFINFQSYFLQKTMPVAMALLRDVQNLCPKDVLNFILDLIKYNDNRKNKFSD
NYYRAELIEALTNSLTPAISINNEVRTVDNLNADVRLILEEITRFLNMEKLLPSFRNTIT
VSCLKAIRELQKNGHIPSDPSLFKSYAEYGHFVDVRIAALEALVDYTRVERSAADLQWLL
TMVQNDPTHYVRHKILGMLSKNPPFTKTSESTLCNEALVDQLWKLMNSGTSHDWRLRCDA
VNLYYSLFGLTRPSCLPLPELGLVLNLKEKKAVLNPTIKPELAVSGGMDTPASIGIHGVG
MSYTAVDDEPDPISLGVCGVGQPPLGLKRKAETPLGSPPEPGQILQQPEDEGRGGRYKIR
FNTMEDEDIDMETVHDSQAFIHQHLNLMERPSTPGKEPLSVEQSMLSMPATPVPSFTKDT
TSSSSKHVSEHSHHHHHHHHEHKKKKKKHKHKHKHKHKHESKDKERERDNSHAYSNSPAS
GRSLRSPSLSD
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgaaccggaagaaggataaagggtttgagagcccgcgaccttttaaattgacccatcag
atggtgtgtatcaacaacatcaacttccagaggaagtctgtcatcggctatgtcgagctg
accatcttccccactgtggtcaacctgaacaggatcaagcttaacagtaaacagtgccgc
atttacagagtccgggtcaatgaacttgaagccccgtttatttacaatgaccccacactg
gaggtgtgccaccatgagtccaagcagaggaacctcaactatttctctagtgcctacaca
gcagcagtgagtgctgtggaccctgatgcaggacacggggagctggtcatcaaagtgccc
tctgaactctggaaacaaggagatgatttgaaagttctaaaggtgtacatagaattctca
ctggaccagccaaaaggaggtctccactttgttgttcctgatgtggagggcagcatggca
gagagaggagctcatgtgttttcgtttggataccagaactccaccagattctggttcccc
tgcgtggactcatactcagagctctgtacgtggaagcttgagttcactgttgatgcttcc
atggtggcagtgtcctgtggtgatctggtggagaccatctacacccatgacatgaggaag
aagacatttcactatgtcctccccattcctacagcctcccctaacatctccctggctgtg
gggccctttgaaatccttgtagacccctacatgcacgaggtgacccacttctgtctgccg
cagctgttgccactgctcaaacactctatgtcttacctgcatgagatttttgagttctat
gaagagattctgacgtgccgatacccttattcctgcttcaagactgtgtttgtggatgaa
tcctacgtgcaagtgtcctcttatgcatccatgagcatctttagtaccaacctgcttcac
agtgctatgatcatagaccagaccccacagacccgtcgctgtctggcccaggccttggct
cagcagttctttggttgtttcatctccaggatgtcatgggctgatgagtgggtgttgaag
ggaatctcaggctacatctacggcctctacctgaagaaaacctttggagtcaacgagtat
cgacactggataaaagaggagctggacaggattgtggactatgaactaaagatgggaggc
gtcctgttgcacccaaccttcagtggaggcaaagagaaagacaatccaactccacacctt
cacttctccatcaagcacccccacacattgtcctgggaatactacaagatgttccagtgt
aaggcccacctggtgatgaggttgatagagaacaggatcagcatggagttcatgttgcag
gttttcaacaagctcctgagtttggccagtacggcctcatcccagaagtatcagagtcac
atgtggagccagatgcttctgtctactcacgctttcctcaaatccatctccaacgtctct
ggcaaggacataggccccctgatcaaacaatgggttgaccagagtgctgtggtgaaattc
tttggaagttttgcctttaacaggaagaggaacgtgttagagctggagatccgtcaggac
tatacatcatctggaactcagaaatatgtgggtcctatcaaggtgacagtgcaggagctg
gatgggtccttcaaacacacactgcagatagaggaaaacagcctcaaacatgacatcccc
tgccactccaagagcagacgaaacaagaaaaagaagatccctctgatgaatggagaggag
gttgacatggatttgtcagctatggacgccgactctcctctcctctggatccggattgac
ccagacatgtccattctgcggaaggtggagtttgagcaggctgacttcatgtggcagtat
cagctgcgctatgagagggatgtagttgcacaggaggaatctatctcagcgctggaaaag
ttcccaactcctgcctccagactggcgttgactgacatcttagagcaagaacagtgtttc
tacaaagttcgcatgcaggcctgcttctgtttggccaggatagccaattctatggtgagc
acatggcagggcccaccagctatgaagtccctgttcaccagaatgttctgctgtaagagt
tgccccaacattgtcaagaccaacaacttcatcaacttccagagctacttcctccaaaag
acgatgcctgttgccatggcgctactcagagatgttcagaacctctgtcccaaagatgtc
ctcaactttatacttgacctcatcaagtataatgacaacagaaaaaacaaattttcagat
aactactatcgcgcagagttgattgaagcactgaccaactctctgaccccagccatcagc
atcaacaatgaggtgcggacagtggacaatttaaatgctgacgtccgtctcatcttggag
gagatcacccgattccttaatatggaaaagctgcttcccagcttcaggaacaccatcact
gtcagttgtctgaaagcaattcgtgagcttcagaagaacggtcatattcccagcgaccca
tcactgttcaagtcctacgctgagtatggacattttgtagatgtacgcatcgctgccttg
gaggctctggtggactatacaagagtggaaagaagtgcagcagacctgcagtggctgctc
accatggtccagaacgacccaactcattatgtcagacataagatcctgggcatgctcagt
aagaatccacctttcacaaagacatcagaatccactctgtgcaatgaagcactggttgac
caactgtggaagctcatgaactcaggtacctcacatgactggcggctacgctgcgacgca
gtgaacctctactactcattgttcggtcttacccgtccttcgtgtctgccgctgccagaa
ttgggcctcgtgctcaacctgaaggagaagaaagctgtgctcaacccaaccatcaagcct
gagctggcggtcagtggtggtatggacacacctgccagtataggtatccatggagtcggc
atgagttacacagctgttgacgatgagccagatcctatttcattgggggtgtgtggcgtg
ggtcagccacctttaggcctgaagaggaaggctgagaccccgctgggctcccctccagag
ccaggacagatactgcagcagccggaggacgaaggcagaggggggcgctacaagatcagg
tttaacaccatggaagatgaagatatcgatatggagactgttcatgatagtcaggccttc
atccaccaacatcttaatctgatggaaagaccctctacaccaggtaaagagccgctctca
gtcgaacagtccatgctctccatgcccgccacgccagtgccctccttcaccaaagacacc
acctcctcttcgtctaaacacgtcagcgagcacagccaccaccatcaccaccaccaccac
gagcacaagaagaagaagaaaaagcacaagcacaagcacaaacacaagcataagcacgaa
agcaaggacaaggaacgagagagggacaactctcacgcctacagcaacagcccagccagc
ggcagatccctgcgctcaccatctctgtccgactaa

DBGET integrated database retrieval system