KEGG   Paralichthys olivaceus (Japanese flounder): 109633088Help
Entry
109633088         CDS       T06037                                 

Definition
(RefSeq) soluble guanylate cyclase 88E-like
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00230  Purine metabolism
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109633088
Enzymes [BR:pov01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     109633088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 109633088
NCBI-ProteinID: XP_019948238
Position
Unknown
AA seq 734 aa AA seqDB search
MYGLYLEAVNDYINESYGEDVWRLIENRAEIPHLKFVRHQMYNDNLILRLAKAAGEVLGK
THDELMYAFGVYMVKRIGNYGYERILKVLGRNVRDFINELDNLHEYFRFSFPKVQPPSFC
VEEECETSLTLHYRSTRKGFTQFVKGQLSQVGRQFYNTDIEVEILSKEETEKMTYVVYKM
NFDNAAFKHRMPQQKTAPSYEKLPMKRGIFFDMFPFSVIFRRDMTMYRIGDGLKEVFSDL
QGKKVDEEFALVRPMLEFSWDNIYTHLNNVFELMSKAVVESKQKVNIPKLNKEEPEEKEE
SEKAKREEERLLIETVEDMIKMGVYVNDLNLHDSSRELILAGTQQSAELQLALDQEQQKY
AQLQEIIKKLDEEKKRGDSLLYAMIPKAVADRLRKGITALETCQVFPDVTILFSDVVKFN
EICIHITPMQVVDMLNEIYIVFDTLSEKHNVYKVETIRDAYMVVAGVPNKTTFHAHHTCD
MALDMLSSIDHLKDPSTGDNIQIRVGIHSGMVVAGVVGLKMPRYCLFGDTVNTASRMESN
GVGMQIHISQTTKDHLEHEPYIIEERGKIFVKGKGYMKTYWLKGKKDLSFKTPAELRYSG
EQKDSEEKSSNGSASPNTKRMASNLNIASSDEQAERKPSPTELPQETLPPQEAPNEPRSP
SVEPQDKEKAKKTRNSKVSRLEVPQATAMVEDLPPTDGLENPGPLLNIKRNSFRQQYAKL
PTNLPMRSASCSIL
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcctgtatttggaagcagtgaacgattacattaacgaatcctatggagaggat
gtgtggaggctgatcgagaaccgagcggagatcccgcacctcaagttcgtcagacatcag
atgtacaatgacaacctgatcctccgactggcaaaggccgccggcgaggttctggggaag
acccacgatgagctgatgtacgccttcggggtctacatggtgaagaggatcggaaactat
ggatacgagcggatcctcaaggtgttgggccgaaatgtgcgcgacttcatcaacgagctg
gacaacctgcacgagtactttcgcttctccttccccaaagtgcagccgccgagcttctgc
gtggaggaggagtgcgagacgagcctcacgcttcattaccgcagcacccgcaaaggtttc
acccagttcgtcaaagggcagctgtctcaggtgggacgacagttctacaacacagacatc
gaggtggagatcctgtctaaagaggagacggagaaaatgacatatgtggtttacaagatg
aactttgacaacgcggccttcaagcaccgcatgccgcagcagaagacggcaccgagctac
gagaagctgccgatgaagcgcggcatcttcttcgacatgttccccttcagcgtcatcttc
cgccgcgacatgaccatgtaccgcatcggcgatggcctcaaggaagtgttctctgacctc
cagggcaagaaggtcgacgaggagttcgcgctggtcagacccatgctggagttcagctgg
gacaacatctacactcatctgaacaacgtgtttgagctgatgtctaaagccgtggtggag
agcaaacagaaggtcaacatccccaaactgaacaaagaggagccggaggagaaggaggag
agcgagaaagcaaagagggaagaagagagattactcatagagacggtggaggacatgatt
aaaatgggtgtttacgtgaacgatctgaacctgcacgattccagcagagagctgatttta
gctgggacgcagcagtcggctgagctgcagctggctctcgatcaggagcaacaaaaatat
gctcagctgcaggaaatcatcaagaagctggacgaggagaagaagagaggcgactctctg
ttgtacgccatgatccccaaagctgtggccgaccgcctgcggaaggggatcactgctctg
gagacgtgccaggtgttcccagatgtgaccatcctgttcagcgacgtggtgaagtttaac
gagatctgcatccacatcacgcccatgcaggtggtggacatgctcaacgagatctacatc
gtcttcgacacgctgagcgagaagcacaacgtctataaggtggagacgatccgtgacgcc
tacatggtggtggccggcgtgcccaacaagaccaccttccacgcacaccacacctgtgac
atggctctggacatgttgagctccatcgaccacctgaaagacccgtccactggggacaac
atccagatcagagtcggtattcactcagggatggtggtggccggtgtcgtgggtctgaag
atgcctcgctactgtttgttcggcgacacagtgaacacggcctcgcggatggagagcaat
ggagtgggcatgcagattcacatcagtcaaaccaccaaagatcacctggaacatgaaccc
tacatcatcgaggagaggggaaaaatctttgtaaagggtaaaggctacatgaagacgtac
tggctgaaaggaaagaaggatctatcgttcaagaccccggcagagctgcgctacagcggc
gaacagaaagactccgaggagaagagctctaatggctccgcaagccccaataccaaacgc
atggcgtccaacctcaacatcgccagcagtgacgagcaagcagagaggaagccgagccca
accgaactcccccaggaaaccctgcccccacaagaggcccccaacgagccccgcagtccc
tcggtcgagccccaggacaaggagaaagccaaaaagactaggaacagcaaggtgtccagg
ttggaagtgccccaggcaaccgcaatggtggaggatttgccacccaccgacgggctggag
aacccgggtcctttactcaacatcaagagaaacagcttcaggcagcagtacgccaagctg
cccaccaacctgcccatgcgcagcgcctcctgctccattctgtga

DBGET integrated database retrieval system