KEGG   Paralichthys olivaceus (Japanese flounder): 109633307Help
Entry
109633307         CDS       T06037                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit-like
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04260  Cardiac muscle contraction
pov04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109633307
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109633307
   04261 Adrenergic signaling in cardiomyocytes
    109633307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pov04040]
    109633307
Ion channels [BR:pov04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109633307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin SUR7 DUF716 L_HMGIC_fpl MIG-14_Wnt-bd Claudin_3 DUF202
Motif
Other DBs
NCBI-GeneID: 109633307
NCBI-ProteinID: XP_019948649
Position
Unknown
AA seq 336 aa AA seqDB search
MSSCSSRALTILSTVFGACGLLLVGVAVSTDYWLIMVEGIILQQNQSMEVKMALHSGLWR
VCFVAGSENGRCVASEYFTEPDIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPREPEQFFNYYYGWSFA
FAASSFLLKEGAGVLSVYLFMKRYAEEEMYRPHPALYHPRLSDSSDYSGQFLHPESSWPP
PKRGRSTSEASSDISIQLNQAPPVPSKSKLQTGAHGSPPSGSSSAGSYPQSAGYPSTHTL
PRSHSSHPQGQALPMPPSPVPPPHYHAHMQMSASPC
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgtgcagcagccgtgcgttgaccatcctgtccacagtgttcggagcctgcggg
ctgctgctggtgggggtggccgtgtccaccgactactggctgatcatggtggagggcatc
atcctgcagcagaaccaaagcatggaggtgaagatggcactgcactcaggcctctggagg
gtttgcttcgtggccgggtcagagaatgggagatgtgttgcctcagagtatttcactgaa
cccgatatagagattaccactgaaaacacagcgaatatcctaaagatggtgcgtacggcc
acaccctttccgatggtgtcgctgctcttcgtcttcaccgccttcgtcatcagtaacatc
ggacacatccggcctcagcgcaccatcctggcctttgtgtccggcatcttcttcatcctc
tcaggcctgagtctggtggtgggcctggtgctctacatctccagcattaatgacgaggtg
atgaaccggccaagggagcccgagcagttcttcaactactactacggctggtccttcgcc
ttcgctgcctcctccttcctgctcaaagagggggccggggtgctgtcagtctacctgttt
atgaagcgttatgctgaggaggagatgtaccgcccccaccctgctctctatcatccccgc
ctgtccgacagcagtgactacagtggccagttcctccacccagaatcctcctggcccccg
ccaaagcgcggccgcagcacctccgaggcctccagtgacatctccatccagctcaaccag
gcgccaccggttccgtccaagagcaagcttcaaacaggcgcccatggaagcccaccctct
ggctcctcctctgcagggagctaccctcagtctgctggttacccctccacacacacactg
cccaggtcacactcctcacatccccagggtcaggcccttcccatgcccccatcacctgtg
cctcctcctcactatcatgcacacatgcagatgagcgcctccccctgttag

DBGET integrated database retrieval system