KEGG   Paralichthys olivaceus (Japanese flounder): 109633582Help
Entry
109633582         CDS       T06037                                 

Definition
(RefSeq) gamma-glutamyltransferase 5-like isoform X1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00430  Taurine and hypotaurine metabolism
pov00480  Glutathione metabolism
pov00590  Arachidonic acid metabolism
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109633582
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    109633582
   00480 Glutathione metabolism
    109633582
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109633582
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pov04090]
    109633582
Enzymes [BR:pov01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     109633582
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     109633582
    3.4.19.14  leukotriene-C4 hydrolase
     109633582
Peptidases and inhibitors [BR:pov01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   109633582
CD molecules [BR:pov04090]
 Proteins
  109633582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 109633582
NCBI-ProteinID: XP_019949124
Position
Unknown
AA seq 550 aa AA seqDB search
MARSKARVYICALLLLCALVLIVCLAVFVRRKCPVGSFSRAAVAADSRKCSEIGRDILQR
GGSAVDGAIAALLCTSIVNPQSMGLGGGSIFTVMDSSGKVKIINARETVPQKFNPDLLKS
CPKTFQLLSGSQWIGVPGEIRGYEQAHRLYGKLPWATLFQPTIQLAREGFPIPPIQGRYI
SHVDTNETQALRKLFSDKDGNLLKTGNIVRFEKLADTFEMIANHGADIFYTGRVAEDLIR
DIQEAGGTLTVQDLASYRVTVTDAWAVPLGEYQLYIPPPPAGGTILSLILNILKGYGLNS
ASLTGELKTLAYHRYVEAFKFANGLKKHIHPQHTSEQMARKFTEDSFADHIRSLISSDKT
HDPRYYNITPHLDSVGTTHVSVLAEDGSAVSVTSTINHIFGSKVFSPSTGVILNNELSDF
CGRVDNLFPGDQPPSSMSPAVLKSQSKTLVIGATGGSMITTGIASTLMNHLWFGKSLKEA
IAAPLVFINSENALRFETNFDKNVIKALKALGHNQEISSIFYNVVNAVEQNDGCICAVSD
ARKLGQAAGY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggtcaaaggcgagggtgtacatttgcgcgctgctgctgctctgcgcgctcgtc
ttaattgtgtgtcttgctgtatttgtaaggcgcaagtgtccagtcgggagtttctcacgt
gctgcagtggccgcagactctcggaagtgttcagagattggacgggacatcctccaacga
gggggctcagcggtagatggcgccattgctgcgctgctgtgcacctccatcgtcaaccct
cagagtatgggcctgggaggggggtcgatattcactgtgatggacagctctggtaaagtg
aaaatcatcaacgccagagagaccgtaccacagaagtttaatcctgacctgctcaagtca
tgtcccaagaccttccagctgctgtcaggtagccagtggattggggtcccaggggaaatt
cgaggatacgaacaggcacacaggctttatgggaagttgccatgggccaccctcttccag
ccgaccatccaactggccagggaagggtttcccatccctccaatccagggtcgatacatc
tcacacgttgatacgaacgagacccaggcactacggaagttattttcagataaggacggg
aacttgctgaagactggcaacatagtgaggtttgagaaactggccgacacctttgagatg
attgcaaatcacggggcagacatcttctacactgggagagtggcagaggatttaatccga
gacatacaggaggcaggaggaacgctcacggtgcaggacttggcgtcgtacagagttaca
gtgactgatgcgtgggctgttcctttgggagagtatcagctgtacatacctccaccccct
gcaggcggcaccatcctcagcctcatcctcaacatcctcaaaggatatggcctgaattca
gcatctctgacaggtgaactgaagactctggcttatcaccgctacgttgaagccttcaag
tttgccaatggactgaagaaacacatccatccacagcacacatcagaacagatggcgagg
aaattcacagaggacagctttgccgaccacattcgcagcttgatcagcagcgacaagact
cacgatccccggtactacaacatcaccccgcacctggacagtgtgggcaccacacacgtg
tcggtgctggctgaggatggatctgccgtgtccgtcaccagcaccatcaaccacatcttt
ggctcaaaggtcttctctccgagcaccggagtcatcctcaacaacgagctgtccgacttc
tgtggccgagttgacaatctctttcctggggatcagcctccctcctccatgtctcccgct
gtgctgaagtctcagtcgaagacgctggtgattggagcgaccggtgggagcatgataacg
accgggatcgcctcgacgctgatgaaccacctttggtttggaaagagcctgaaggaggca
atcgctgcccctcttgtttttatcaactctgaaaacgcactgaggtttgaaaccaacttt
gacaagaatgtaatcaaggctcttaaagctctgggacacaatcaagagatatcgagcatc
ttctacaacgtggtcaatgccgtggagcagaatgacggctgtatctgtgcagtgtctgat
gccaggaaactgggccaagcagccggatactga

DBGET integrated database retrieval system