KEGG   Paralichthys olivaceus (Japanese flounder): 109637149
Entry
109637149         CDS       T06037                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109637149
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109637149
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109637149
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 109637149
NCBI-ProteinID: XP_019954894
Position
Unknown
AA seq 964 aa
MCHVCHCLVVSKKDWVRGFPAFSVTMSVAPLLLLLFLPFPPSSGAQLPNQSQSKEPPIAT
NGQLFPWDRMRLPQTIYPLHYDLSIHPNLTTLDFTGLVRIELDVIEDTSMIVLHAKKMQI
SNVLLLAPEGVRPLQVLEYPHFHQLALLSDSVLTKGRKYEVQLEFAANLSDSYHGFYKSS
YRTSSGEVRFLASTQFEATFARGAFPCFDEPAFKANFTIQIIREPRHITISNMPKVKTVE
LPGGLLEDHFDTSVRMSTYLVAYIVSDFLSVSKTTKHGVKISVYAVAEKIDQTAFALDAA
VTLLDFYDDYFDIPYPLPKQDLAAIPDFQSGAMENWGLTTYRETGLLFNAERSSASDKLG
IAKVIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEYVSLRVTYPELQVDDFFLGKCFE
AMEVDSLSSSHPVSTPVENPMQIQEMFDDVSYDKGACILNMLRDFLTPEAFEIGIIKYLK
RFSYQNTVNSHLWESLTDICSSDDLDEGRMKHEDFCSKRKVQSGASKWYSGDELDVKAIM
DTWTLQEGFPLVTVEVRGREVRLSQERYLKTDDPSLTEGFLWQIPLTYVTSASNTVHRFL
LKTKTDVLYLPEEVEWVKFNVDMCGYYMVHYAGEGWNSIIRLLHHNHTALTSNDRASLIQ
NVFQLVSIGKVRLDTALELSLYLSRETEIMAVTQGFGELVPLYKLMEKRDMEVLENQMKT
YIVDLFRGLIDRQEWSDSGSVSERVLRSYLLLFACVRNYAPCLTKATQLFNKWKESDGNM
SLPVDITMAVFVIGARTPEGWDFLFEKYRNSMQMSVKFRMKSAMTVTSLQDKLKWMMEQS
LHGEVMKTQDLPDVVVAVSRNLHGYKLAWDFFRANWHTFIKKFDLGSNTISYMVKGVTNQ
YSTREMLHEVQSFFGSLTEETGSEMRCIQQSYESIEDNIRWMDTNLPLLKAWLDRRSHKV
HDDL
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgtgccatgtgtgtcattgtctagttgtgtcgaagaaagactgggtgagaggatttcct
gctttcagtgtcaccatgtcagtggctcctctcctgctgctgctgttccttcctttccct
ccctcatctggagcccagctgccaaatcagagccaatccaaggaaccccccatcgccacc
aacggccagctgttcccatgggaccgcatgagacttccccaaaccatctacccgctccac
tatgacctctccatccaccccaacctgaccaccctggacttcactggcctcgttcgcatc
gagctggacgtgattgaagacaccagcatgatcgtcctccatgccaagaagatgcagata
tctaacgtgctgctcctggcgcccgaaggcgtgaggcctctccaggtgctggagtatcca
catttccatcagctcgccctgctgtcggattccgtgctgactaaaggaaggaagtatgaa
gttcagctggagtttgctgccaacttgtctgacagctaccacggtttctacaagagcagc
taccgcaccagcagcggggaggtccggtttctggcgtccacacagtttgaagcaacgttt
gctcgtggagccttcccctgttttgatgaacctgctttcaaagccaacttcaccatacag
atcatacgagagccgcggcacataaccatatccaacatgcctaaggttaaaacagtggag
ttgccaggcggtttgctggaggatcactttgacacctctgttaggatgagcacgtacctg
gtggcctacattgtgtctgatttcctgtctgtgagcaagaccaccaagcacggcgtcaag
atttcagtctacgctgtagctgagaagatcgatcagacggccttcgctctggatgctgct
gtcactctgctggacttctacgatgactactttgatattccttacccacttcccaaacag
gacctggctgctatccctgatttccagtcaggtgcgatggagaactgggggctgacgacc
tacagagagacgggcctcctcttcaacgcagagaggtcttcagcttcagacaaactgggt
atcgctaaggtcatcgcccatgagctcgcacaccagtggttcgggaacctggtgacgatg
gagtggtggaacgacctgtggctcaacgagggtttcgccaaattcatggagtatgtttct
ctccgcgtcacgtacccagagctgcaagtggacgactttttcttgggaaaatgttttgag
gccatggaggtggactccctcagctcctctcacccagtctccacccccgtggaaaacccc
atgcagatccaggagatgttcgacgacgtgtcatatgacaagggagcatgtattctgaat
atgctgcgggacttcctgaccccggaggcctttgagatcggcatcatcaaatacctaaag
cgcttcagctaccaaaacacagtcaacagccacctgtgggagagcctaaccgatatctgc
agctcagatgatttggacgaaggtcgaatgaaacacgaagatttctgctccaaacgcaaa
gtccagtctggagcctctaagtggtactctggtgatgagctggacgtcaaggccatcatg
gacacctggacgttgcaggagggcttcccgctggtcactgtggaggtcagaggtcgcgag
gtcaggctcagtcaggagcgttacctgaagacggacgacccctccctcactgaaggattc
ctgtggcagattccactcacctatgtgaccagcgcctccaacactgtccaccgcttcctg
ctgaaaaccaagactgatgtcctgtatctgccagaggaggtggagtgggtgaagttcaac
gtggacatgtgtggctactacatggtccactatgcaggcgaggggtggaactccatcatc
agactgctgcaccacaaccacacggctctgaccagcaacgaccgagccagcctcatccag
aacgtcttccagctggtcagtatcgggaaggtgaggctggacacagctctggagctgtcg
ctctacctgtccagagagactgagatcatggctgtgactcagggcttcggagaacttgta
cctctctacaaactgatggagaagagagacatggaggttctggagaaccagatgaagacc
tacattgtggatctgttccgggggctgattgatcgtcaggagtggtctgactctggatcg
gtgtctgagcgagtgctcaggagttacctgctcttgttcgcctgtgtcaggaactacgcc
ccctgtctgaccaaagccacacagctcttcaacaagtggaaggaatctgatggcaacatg
agtctcccggtcgacatcaccatggctgtgtttgtgattggagctcgaactccggagggg
tgggacttcttgttcgagaaataccgcaattcgatgcaaatgtctgtcaagttccgcatg
aaatccgcaatgactgtcacttcgctgcaggacaagctcaagtggatgatggagcagagc
ctccacggtgaagtgatgaagactcaggacctcccagacgtggtcgtcgccgtcagcagg
aacctccacggctacaaactggcctgggactttttccgagccaactggcacaccttcatc
aagaagtttgacctcggctccaacacaatctcatacatggtgaagggtgtgaccaaccag
tattctaccagggagatgctgcatgaggtacaaagcttctttggctccctgaccgaggag
acgggctcagagatgagatgtatccagcagagctacgagagcatcgaggacaacatccgc
tggatggacaccaaccttcctctgctaaaggcctggctcgaccgacgcagccacaaagtg
catgatgatttatag

DBGET integrated database retrieval system