KEGG   Paralichthys olivaceus (Japanese flounder): 109637757Help
Entry
109637757         CDS       T06037                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04020  Calcium signaling pathway
pov04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109637757
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109637757
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pov04030]
    109637757
G protein-coupled receptors [BR:pov04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    109637757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srx DUF5409 CBFB_NFYA TMEM208_SND2
Motif
Other DBs
NCBI-GeneID: 109637757
NCBI-ProteinID: XP_019955871
Position
Unknown
AA seq 358 aa AA seqDB search
MDNNSLGFLREANTSLQIELQSCATFRNQVSRIFVYAFLSVGIACTVVGNFLVVLSIAYF
KQLQSPTNSFVMSLAVADCLVGLVVMPYSMIRTVEGCWYFGALFCQLHSSLDVMLCTASI
FHLSCIAFDRYYAVCNPLIYSLKMSHNRVAFLIVVCWAVPMLISFCPIMLDLHIAGVDIL
LPKDVCVFLVNRIYAVMASLVAFYLPMAIMLIAYWKIFKAAKRQARQISAMESQMAAGVG
KDSSKKQRHRKAMKRERKAAKTLGIIMGVFLIFWMPFFTVNIVDPFIGYSTEVVVWDVFL
WLGYINSSLNPFLYGFFNRSFRRAFLMFIGCRVCLPGSSPGMELSHTRKEANERAHQP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacagcctgggatttctcagagaagctaacacatctctccagattgaactt
cagtcctgtgctacatttcgaaaccaggtctcgcgcattttcgtgtatgccttcctctct
gttggcatcgcctgcacagtggtgggaaatttcctggtggtcttgtccatcgcctacttc
aagcagttgcagtcacccacaaattcttttgtcatgtctttggcagtggctgactgtctt
gttggcctggttgtgatgccttacagtatgattcggacggttgagggatgctggtacttt
ggtgcccttttttgtcagcttcactccagcttagatgttatgctttgcactgcctccata
ttccatctcagctgcattgcctttgaccgctactacgctgtgtgcaacccgcttatctac
tctttaaagatgtcccacaatcgagtagctttcctcattgttgtatgttgggcagttccc
atgctcatttccttttgtcccataatgctagatcttcatattgctggtgtggacatcttg
ctccctaaagatgtctgcgtgttcttggtcaatcgcatttatgctgtcatggcttctttg
gtagccttttacttgccaatggctataatgttgatagcatactggaagatcttcaaagct
gccaaacggcaggccaggcagatcagcgccatggaaagccagatggctgccggtgtgggc
aaagactcaagcaagaaacaacgacaccgaaaagcaatgaaaagagagagaaaggcagca
aaaactttaggcatcatcatgggagttttcctaatcttctggatgccgttcttcacagtc
aacattgtggacccatttattggatacagcacagaggtggttgtctgggatgtattttta
tggctaggatatatcaactcatctctgaatcccttcctgtacggtttcttcaaccgttcg
ttccgtagggcattcctcatgttcatcggctgcagggtatgccttcctggatcctcccca
gggatggaactatctcacaccaggaaggaggcgaacgaacgtgctcatcaaccataa

DBGET integrated database retrieval system