KEGG   Paralichthys olivaceus (Japanese flounder): 109637917
Entry
109637917         CDS       T06037                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pov03021]
    109637917 (aff3)
Transcription machinery [BR:pov03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     109637917 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 109637917
NCBI-ProteinID: XP_019956147
Position
Unknown
AA seq 1184 aa
MPTVLGGREKLSIVCFLLRCAYSQVTGSQRNSCAKDILEDMTQSWPSQQALGGEQAQHIL
YNPKDVKQSTQQRQSRGDVQLRMTRNPRVAPHKSMLADDLKLSSDDDDTQRAPHESAPWD
RHSLSAQRAHTHGRRVRHSSSDSSGSDSTVGSGSSSIRSRSPSPDVHPDPGSPANVQPLC
NHKETNHPAAAQWQLDKWLKKSHKKSASSEQDPSQSARRRLPSPHTQRAPSPARSWDSNQ
EYSPSQSPIPSPQFNYSHNNTPLPSPGYSYCPSPSPFTSTCPSPSPRHISIPSPALSVCL
SPCGSPRGSRSPSPLPTHPPRSPSPSLPSPSRLRHYPEIQTQTVQTTNPHRTKVRSWIPP
LPNTDTKNKPTNGSHPQATHQHQPRARPTQEQSKSKASASVLNSGLNHSQKSRPKSNFHP
NSKALSEAPKAKHKLHFEQIQGSRSNHSSDNKPRPLFQRGSQLNPTRAKHLAPASRETNA
GHASHLQSTSKAAANSASGSNSSASSSLKPRTKPSEASVQTPVHVNHTKASKKKPQTKEQ
EVDHRRDHPTEGRKHERKEDRHREKPKGKEERKEDRRLAEEQLLRRPWIQSSAEEEEEEE
EEEGVIERQRRREETAKGENRRKEQQHRRDWQTRTRLPTDAKRHQPKDDSYHQGATKRGG
RAEEERELQLELSPPPSRCPTPHRPSSSSSSSHSDSESERIIAKVPADSTSHKRLTKRGQ
QGPGRPEANRPKAAPPRGATAHPSEGQQGENRQKLYTLVPFGRGEQAAASSQRGLRNLVV
QIDLCLLKRVPDSTSGPAVKKLSSSPSSSSSTRDKQRDSMKHLYTPETVTKDGKRKRKLE
NGVSQRESKRSLPHAGDGLSDRTEPSAHTAGPDFVTETTHNGFLEEYLDSKRPLSPLSPL
SPLSPLSNSPKSTKPPKTKTSEQHHSHKNRDKTKDSAVKPKMEVECVKVSRQTQPPSECW
GPAGHQGTVNKYETPHHAEYYLHEAKRMKHRADAMVDKLGKAVNYVDAALSFMECGKAME
EGPLEAKSPYTMYSETVELIRYAMRLKSHSGPGARQEDKQLAVLCFRCLALLYWQMFRLK
KDHALKYSKVLLDYFKGSPKVPSTPPCWNESGKDAGGAPLSLSPNAKHPAGSSHGGSNSP
SFISIPQRIHQMAANHLNITNSVLYSYEYWEVADNLAKENKGKI
NT seq 3555 nt   +upstreamnt  +downstreamnt
atgccgactgtcctcggcggcagagagaaactttccatcgtctgttttctgctccgatgc
gcgtattctcaggtaacaggaagccaacgcaacagctgtgccaaagatattctggaggac
atgactcagtcgtggccgtcccagcaagccttagggggtgagcaggcccaacatatcctc
tacaacccaaaggacgtgaaacaatcgacacagcaaaggcaaagtcggggggatgttcag
ctgcgaatgacccgtaaccctcgtgtggcacctcacaaatccatgctcgctgatgacctg
aagctgagcagtgacgacgatgacactcagagggcccctcacgagtcagcgccctgggac
agacacagcctgtcagcacagcgagcgcacacacatggcaggagggtgagacattccagc
tcagactcctcgggctcagactccaccgtcgggtcgggcagcagcagcattcgttcccgc
agcccgagcccagacgttcacccagaccctgggtcgccggcgaacgtgcagccgctgtgc
aaccacaaggagactaatcaccccgctgcggcgcagtggcagttggacaaatggctgaag
aagtcccacaaaaaatctgccagcagtgaacaggatccatctcagagcgctaggagacgc
ttgccctctccccacacccagcgcgccccatccccagccaggtcctgggacagcaatcag
gaatacagccccagtcaaagccctattccaagcccacagttcaattacagccacaacaac
acccctcttcccagccctggttacagctactgtccgagccccagcccctttacaagcacc
tgccccagccccagcccaaggcacatctccatccccagtccagctctgagtgtttgcctc
agtccgtgtgggagcccaaggggcagccgcagcccgagcccccttcctacacatcctcca
agaagcccaagtcccagcttaccatctccttcaaggcttcgtcactaccctgagattcaa
acacaaactgtccaaacaaccaatccccacaggacaaaagttaggtcatggatccccccg
ttgcctaacacagacaccaagaacaagcccacgaatggttctcaccctcaggcgactcat
cagcaccagcccagagctcgaccaacacaagagcaaagcaaatccaaggcctctgcttct
gttttaaactctggcctgaatcacagccagaaatctagacccaagtctaactttcatcct
aattctaaagcgctgtcagaggctcccaaagccaaacacaaattgcattttgaacaaatc
cagggcagcaggtccaaccacagctctgacaacaagcccaggcctctgtttcaacgcggc
tcacaacttaaccccactagagcaaagcacttagctcctgctagtcgtgaaaccaacgct
ggtcacgcttctcacttgcaatctacctctaaagctgctgctaattctgccagtgggtcg
aactcgagtgctagttcgagtcttaaaccaaggaccaagccgtcggaggcctcagtgcag
actcctgtgcatgtgaatcatactaaagcatcaaagaagaaaccccagaccaaagaacag
gaggtggaccacagacgagatcatccgacagaggggagaaaacacgagaggaaagaggac
agacatcgggaaaaaccgaaaggtaaagaggagaggaaggaagacaggaggctggcggaa
gagcagctgctaagacgtccctggatccagagttcagcagaagaagaagaggaggaggaa
gaggaggaaggagtgatagaaaggcagaggagaagagaggagacagcaaaaggggagaac
aggaggaaggagcagcaacatcgacgtgattggcaaaccagaacaagactgcccactgat
gccaagcgacaccaacctaaggacgactcataccaccagggggcaacgaaaagggggggg
agagctgaggaggagagagagttacaactggaactttcacctcctccatcacgttgcccg
acacctcatcgaccgtcctcctcatcctcttcctcgcattcagattcagaatctgaacgt
attatcgccaaggttccagccgactccacctcccacaagagactcaccaagagagggcaa
caaggcccaggcaggcctgaagccaacaggcccaaggcagcgccccccagaggagccact
gctcatccaagcgaggggcagcagggtgagaacaggcaaaaactctacaccctagtcccg
tttgggcgaggggaacaggctgcagcttcttcccagcgagggctcagaaacctggtggtg
cagatcgacctctgtcttctcaaacgagtcccggacagcacgagtggtcccgctgttaaa
aaactctcttcctctccctcctcctcctcgtcaaccagggacaagcaaagagacagcatg
aaacacctgtacacacctgagactgtgacaaaagacggaaaaaggaaacgcaagctggag
aacggtgtgtcacagagagaaagcaagaggagtcttccccatgcaggagacggcctctcg
gatcgcacagagccgtcagctcacacagctgggcccgactttgtgacagagaccacacac
aacgggttcttggaggagtacttagacagcaagaggccactgtctccgctgtctccactg
tctccactgtctccactgtccaacagcccaaagtccaccaaacctcccaaaaccaagact
tcagagcagcatcacagccacaagaacagagacaagaccaaagattctgctgtgaagccc
aagatggaggtggaatgtgttaaagtgtccagacagacccagcccccgtctgagtgctgg
ggccctgcaggacaccaggggactgtgaataaatatgaaactccacaccatgcagagtac
tacttacatgaagctaaaaggatgaagcatcgagccgacgcaatggtggacaagctgggg
aaagctgtgaactacgtggatgctgctctctccttcatggagtgtgggaaagccatggag
gaaggaccgctggaggctaaatctccgtataccatgtactcagagacagtggagctcatc
agatatgcaatgaggttgaagagccactctggccctggggcgagacaggaagacaaacag
ctggcagttctgtgtttccgatgccttgccctactttactggcagatgtttcggttaaag
aaggaccacgctctgaaatactccaaagtactgctcgactattttaagggttctcccaaa
gtcccttctacaccaccctgctggaatgaatctgggaaggatgcaggaggagcccctctg
tcgctctcgcccaacgccaaacaccctgcagggagttcacatgggggcagcaactccccc
tccttcataagcattccccagcgtatccaccagatggcagcaaatcacctaaacatcacc
aacagtgtgctgtacagctacgagtactgggaggtggccgacaacctcgctaaggagaac
aaaggtaaaatttga

DBGET integrated database retrieval system