KEGG   Paralichthys olivaceus (Japanese flounder): 109638074
Entry
109638074         CDS       T06037                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 2-like
  KO
K13723  endoplasmic reticulum aminopeptidase 2 [EC:3.4.11.-]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109638074
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109638074
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109638074
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N BLOC1S3
Other DBs
NCBI-GeneID: 109638074
NCBI-ProteinID: XP_019956414
Position
Unknown
AA seq 938 aa
MVLVMLLALSLLHMSPVECQPTQHSSPPGAQPPLGTDNLSFPWSRLRLPRYIIPLHYQLL
LHPNLTSLSFTGSVQIQIDVQNSTNWVVLHSKDLQIFKATILNQNLDHLSDQVLPVLHNP
SHEQIGIFSPRVLSSGQKYFLYIEFGAELAEGFYGFYGSTYRTSTGEMRTLASTHFEPTS
ARMAFPCFDEPKFKANFSVRIRRSPEQISLSNMPVVKTVEVSDILLEDWFAVSVKMSTYL
VAFVICDFRSVTATTSSGVQVSIYAAPGKWHQTHYALEVAVKMLDFYEEYFNIHYPLPKQ
DLIAIPDFQSGAMENWGLTTYRETSLLFDPRTSSVSDKLWVTMVIGHELAHQWFGNLVTM
AWWNDLWLNEGFARYMEFISVEATYPELSVEEYLLHTCFIAVGHDSLNSSRPISSTAENP
TQIEQMFDSFSYEKGACVLHMLRHFLTDDVFQRGIVRYLRKYSYNNAVNQDLWDSLTNTC
SEEDFISGKHCYSSSQATKNAYLFAGEHLDLTAMMNTWTLQRGIPLVTVTRKGDRLLLRQ
DRFLRTVLPSDPLWPTLQKGFLWHIPLTYKTDASSTIHRHLMTTHTDSVHIGEEVSWVKV
NTDMTGYYVVHYEDDGWDEMTKLLRENHTALSYKDRTQLIHNSFQLVTAGHLPISKALDL
IGYLRQETHIVPLLEGLGYLETYYHVIEKRNESELTHDLGTYILRFFRAIIDQQTWSDSG
SMSERRLRSEVLSLACHLEDPRCLQRARQSFTDWLKSNGTLNLPTDVAETVYSVGAQDDH
GWASLLHTYNISLSEALKSKILFALTCSKDTSKLERLLELGLEGKVIRSQDLSGLILMVS
RNAQGHHLAWNFVKNNWDMLVKKFHLASSCIRNVIVGTTGQFYSTEELTEVQSFFESIKE
QSSQLRATQVALENMQKNVRWIQRNLETLRNWLHEQMK
NT seq 2817 nt   +upstreamnt  +downstreamnt
atggtattggtgatgctgttagcactgtctctacttcacatgtctccggttgagtgtcag
cccacccagcattcaagtcctccaggagcacaacctcctttgggtaccgataatctgtcc
ttcccctggagccgtcttcgcctgccgaggtacatcattcctcttcactaccaactcctc
ctacaccccaacctcacgagtctcagtttcaccggctcagtgcagatccagatcgatgtc
cagaacagtaccaactgggttgtgttacacagcaaagatctgcagatctttaaagccacc
atattgaaccaaaacctcgatcatctctctgaccaggttcttccagttcttcataaccct
tcgcatgagcagattggcattttctctcccagggtgctcagcagtgggcaaaagtacttc
ctgtatattgagtttggggcagagctagcagaaggattctatggcttctacggtagcacc
tacagaaccagtacaggagagatgagaaccttggcttcaactcactttgagcccacgagt
gctcgcatggcgttcccttgttttgatgagccgaaattcaaggccaacttctctgttcgg
attaggaggagcccagagcagatttctctctccaacatgcctgtagtcaagacagtcgaa
gtaagtgacatcctgctcgaggactggtttgctgtgagcgtgaagatgagcacgtacctt
gtggcatttgtcatctgtgacttcagatctgtcactgcaacaacatcctctggagtgcag
gtgtccatctatgctgctcctgggaagtggcatcagacacactatgccctggaggttgct
gtgaaaatgctggacttctacgaggaatacttcaacattcactatcctctccccaaacaa
gatctgatcgccatcccagactttcagtctggtgcaatggagaactggggtctgaccacc
tacagagagacaagccttctctttgacccccgcacttcctctgtgtctgataaactctgg
gttactatggtgatcggacatgagctcgcccatcagtggtttggtaacttggtgaccatg
gcatggtggaacgatctctggctaaatgaaggatttgccagatacatggagttcatttca
gtggaggccacctaccctgagctctctgtggaggaatatctgctgcacacctgctttata
gcagttggccacgattcgttgaattcctctcgtccaatatccagcacagcagagaacccc
actcagatcgaacagatgtttgactcattctcctacgagaagggagcgtgtgtcctgcac
atgctgcgacactttctgactgatgatgtgtttcaaagggggattgtgcgatatctacgc
aagtacagctacaataatgcagtcaaccaggatctgtgggacagtctgactaatacatgc
tcagaagaagacttcatctctggaaaacactgttacagcagcagtcaggccaccaagaat
gcatacctgtttgcaggggaacatctggatctgacggccatgatgaacacttggactctg
caaagaggtattcctctggtaactgtgaccaggaagggggatcgtctgctgctgagacag
gacaggttcctgagaacagtgctgccctctgaccctctctggcccacactgcagaagggt
tttctttggcatatccctctgacatacaagacagatgcttccagcacaattcacagacac
ctgatgacgacacacacagacagtgtccacataggagaggaggtcagttgggtgaaggta
aacactgacatgactggctattatgtggttcattacgaggacgatggttgggatgagatg
accaaactgctaagagagaaccacaccgctctgagctacaaagacaggactcagctcata
cacaactcttttcaactggtcactgcaggtcacctgccgataagtaaagccttagacctg
attggttatctgcgacaggagacacacatagtgcctctccttgaaggactgggatatctg
gaaacatattaccatgtgattgagaaaaggaatgagtctgagctaacacacgacctgggg
acgtacatcctgcgatttttccgtgccatcatcgaccagcagacatggagtgacagcggc
tctatgtcagagcgacggctgaggtcagaggtcctgtctctggcttgtcacctggaagac
cctcgctgtcttcagcgggcacgtcagagcttcacagactggttaaagtctaatggaaca
ctaaatttacccactgatgtggcagagaccgtgtattcagttggagcacaggatgaccat
ggctgggcctcgctcttacacacatacaacatctccctctctgaagcactaaaaagcaaa
atcctgttcgccttgacctgtagcaaagacaccagcaaactggaaagactgctggagttg
ggactggaagggaaggtgattcgatctcaggacctgtctggtctcatcctgatggtgagc
aggaacgcgcagggacatcacctcgcctggaactttgtcaaaaacaactgggacatgctg
gttaaaaagttccacttggcctcatcttgcattagaaacgtcatcgttggcaccacaggc
cagttttactctacagaggagctcactgaagtgcagtccttctttgagtccatcaaagag
cagtcatctcagctgagagctactcaggttgcccttgaaaacatgcagaaaaatgttcgc
tggattcagaggaacctggagactctgagaaactggctccatgagcaaatgaagtga

DBGET integrated database retrieval system