KEGG   Paralichthys olivaceus (Japanese flounder): 109638180
Entry
109638180         CDS       T06037                                 

Gene name
lnpep
Definition
(RefSeq) leucyl-cystinyl aminopeptidase
  KO
K01257  cystinyl aminopeptidase [EC:3.4.11.3]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109638180 (lnpep)
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.3  cystinyl aminopeptidase
     109638180 (lnpep)
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109638180 (lnpep)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF3876
Other DBs
NCBI-GeneID: 109638180
NCBI-ProteinID: XP_019956595
Position
Unknown
AA seq 1033 aa
MDPFDSNSAERANLPRNMIENSMFEEEPDVVDLAKDSAAFPTFPALDPDEVVFEPRSSRL
LVRGLGENEMDEEEEDCESSARLLGMSFMNRSSSHRPNSSPYTRQNPPRSCSRPSARTMV
VCVLFLVIVASMTMVLYFLPECTFTRAGCRKPNNTTPQEIVYPIATNGELFPWAQFRLPH
SIRPLSYNLTLSPDLDNMTFTGRTVINMYVLHNTKRIILHSANLHITKATFKLGDGEAND
VTILEYKPRQQIAIKFSAELKSDQYCVLTLEYSANFSQTYDGFYNSSYTDKDGNKNVLAA
TQFEPLSARKAFPCFDEPSFKATFLITINRKTDYTAVSNMPLAKSTPLSGGLIQDEFEKT
TVNMSTYLVAFIVANFTPISKNVSNIQVSVYSVPEKKEHTEYALETASQLLEFYNTFFEI
DYPLKKLDLVAIPDFLAGAMENWGLITFRETSLLVGKQSSPLEKQVVASVVAHELAHQWF
GNLVTMSWWNDLWLNEGFATYMQYMSLQKTMPQLDIGNLFLAVRFRAMDKDALNSSHAVS
TEVNTKEQVEEMFDSVSYEKGASILLMLNASLPGDQQFRKGIIQYLKQFSGLNTDTADLW
NSLTQVSTQHQNVSEMMSSWTSQKGFPLVTVSRKGDQVTLTQEHFLLTSDNATHTSSLWN
IPVTYVNDSCSFAPECRQVFNLKTKTGTFKLPESVKWLKLNYRNSGFYIVHYSNEGWAAL
KDALSNNVSVLTHEDRAALIHNIFALSRLGRVSFHQVLTLLNYMSNETETTPVMEALLQL
ESIHRLLDKRQEEALVARMKNYIFHNFGSLMDKQTWGEEESVSKQELRSALLQMACSLNE
KKCIQQAKALFKQHVESNGTLRIPGDLQQVVFTVAAQSDEGWETLLQMYGHATYDADKRK
MLQGLASTQNIRQLVWILKAGLSGNIIQTQELPLVINTMVKGFAGHLFVWDFVQENWDRL
IEKFSVGSFAIQTIVKSATFQFSTQAHLDQVQSFFSGLKERGSQMRSVQEALETIRLNQR
WMDKNLPTLQKWL
NT seq 3102 nt   +upstreamnt  +downstreamnt
atggatccattcgacagtaacagtgcagagcgagccaacctgcccaggaacatgattgag
aacagcatgtttgaagaggagcctgatgtcgtggatttagccaaagactctgctgcattt
ccgacgtttcctgctcttgacccagatgaggtagtgtttgaacctcgtagttcacgtttg
cttgttcgaggcctgggagagaatgaaatggatgaggaagaggaggactgcgagtcttca
gcccgtctgttgggcatgtccttcatgaatcgtagctcttctcacagacccaactcttcc
ccgtacacaagacagaatccacccaggtcatgttcacgaccttcagccaggacaatggtt
gtatgtgtgttattccttgttatagtggcctctatgaccatggtactgtacttcctaccc
gaatgcaccttcaccagagcaggttgtcgtaaaccaaacaacaccactccccaggagata
gtctaccctattgccaccaatggcgaactgtttccatgggcccagttccggctgcctcat
agtatacgtcctctcagctataaccttaccctgagccctgacctcgacaacatgaccttc
actgggcgcactgtcatcaacatgtatgtgttgcacaacaccaagcgtatcatcctgcac
agtgctaatctgcacattaccaaagctacattcaagctgggtgatggggaggccaatgat
gtgactatactggagtacaaacccagacagcagattgctattaaattctctgcagagctg
aagtcagaccagtactgtgttttgaccctggagtactctgccaacttctcacagacctat
gatggtttctacaacagctcttacactgataaagatggaaacaaaaatgttcttgcagca
acccagtttgaaccactgtcagccaggaaggccttcccttgcttcgatgaaccatctttc
aaagccacctttcttattacaatcaacagaaaaacagactacacggctgtttccaacatg
cctttggctaaatccacacccctctctggtggcctcatccaagatgagtttgaaaaaacc
actgtcaacatgagtacctatctggtggccttcatcgttgctaatttcaccccgatcagc
aaaaatgtctcaaacattcaagtatctgtgtactctgtgccagagaagaaggagcacact
gaatatgctctggaaacagcctcccaactgctggagttctacaatacgttctttgaaata
gactaccccctcaaaaaactagacttggtagccatcccagacttcttggcaggagccatg
gagaactggggactcatcactttccgtgagaccagcctgctggtgggcaaacagtcctcc
cctctggagaaacaagttgttgcttcagtcgtagcgcatgaactcgctcatcagtggttt
ggaaacttggtgactatgagctggtggaacgacctgtggctcaacgaaggctttgccact
tacatgcagtacatgtcactgcagaaaacgatgcctcagctggacattggtaatttgttc
ctggcagtgcgtttcagagccatggacaaagatgcacttaactcctcccatgctgtgtcg
acagaggttaacacaaaggaacaggtggaagagatgttcgactctgtctcctatgaaaag
ggtgcatccattcttcttatgctgaacgcgtccctgccaggggaccaacagttcagaaaa
gggatcattcaatacctcaaacagttcagtggattaaacacagacactgccgacctctgg
aacagccttacacaggtgtcaacacagcaccagaatgtatcagagatgatgagctcatgg
acctcacagaaaggcttcccattggtcactgtaagccgcaagggagatcaagtgaccctc
acacaagagcacttcctcctcacatctgacaatgccactcatacttccagcctgtggaat
ataccggtgacgtacgtaaacgacagctgtagttttgcccctgagtgcagacaagttttt
aatctgaagacaaagacaggcacttttaagctgccagaaagtgtaaagtggctgaagttg
aactacaggaactcaggcttctacatcgtgcactacagtaatgaaggctgggctgctctt
aaagatgctttgtccaacaacgtcagtgttcttacacatgaagaccgtgccgcgctcata
cacaacatctttgctctctccagactgggaagggtatccttccatcaagtcctcactctg
ttgaactacatgtcaaatgaaacagagactactcctgtgatggaagccttgttacagctc
gaaagtatccacaggctgctggacaaaagacaggaggaagctcttgtggcccgtatgaag
aattatatttttcacaattttgggtctctgatggacaaacaaacatggggagaggaggag
agtgtgtccaaacaggagctgcgctcagcccttctgcagatggcgtgtagtctgaatgaa
aaaaaatgcattcagcaagctaaagccctgttcaaacagcatgtcgagtccaatgggact
ttacgtataccaggtgatctgcagcaagttgtgttcactgtggctgctcagtcagatgaa
ggttgggaaactttgcttcaaatgtatggacacgccacctacgatgcagacaagagaaaa
atgctacaggggctggcatccactcagaatatacggcagttagtgtggatccttaaagca
ggtctgagcgggaacatcatccagacacaggagttgccattggtcatcaacaccatggtt
aaaggcttcgctggccacttgtttgtctgggattttgtacaagagaactgggaccgactc
atagaaaagttttctgtgggctcctttgccatccagacaatcgtcaaatctgccaccttc
cagttctctacacaagcgcaccttgaccaggttcagagtttcttctctggcctgaaggag
cgtggctctcagatgagaagcgtacaggaagctttggaaacaatcaggctaaatcagcgc
tggatggacaagaatctacctacactccaaaaatggctctaa

DBGET integrated database retrieval system