KEGG   Paralichthys olivaceus (Japanese flounder): 109639148Help
Entry
109639148         CDS       T06037                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-2-like
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04260  Cardiac muscle contraction
pov04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pov00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109639148
   04261 Adrenergic signaling in cardiomyocytes
    109639148
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109639148
Enzymes [BR:pov01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     109639148
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109639148
  Exosomal proteins of other body fluids (saliva and urine)
   109639148
  Exosomal proteins of colorectal cancer cells
   109639148
  Exosomal proteins of bladder cancer cells
   109639148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Hydrolase_3 Cation_ATPase
Motif
Other DBs
NCBI-GeneID: 109639148
NCBI-ProteinID: XP_019958015
Position
Unknown
AA seq 972 aa AA seqDB search
MGRGCGAENGGKRKKKDRDLDELKKEVAFDDHRIPLDDLGKRYGVELTRGLTNARAVEIL
ARDGPNSLTPPPTTPEWVKFCRQLFGGFSVLLWIGATLCFLAYCIQVATEDEPPNDNLYL
GVVLAAVVIITGCFSYFQEAKSSRIMDSFKKMVPQQALVIREGEKMQINAELVVQGDLVE
IKGGDRIPADLRVISSSGCKVDNSSLTGESEPQTRSPELTNDNPLETRNICFYSTNCVEG
TAHGIVIATGDRTVMGRIATLASELEVRQTPINIEIEHFIHIITGVAVFLGVSFFILSLI
LGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTST
ICSDKTGTLTQNRMTVSHMWFDNQIHEADTTEDQTGLGFDKSSATWTALSRVAGLCNRAD
FKAAQEHLPLQMVLTSTPRLSVHEVEDNPSGHILVMKGAPERILDRCSSIMVQGQEQTLD
ENWREAFQNAYMELGGLGERVLGFCHLNLSSAQFPRGFTFDCDDTNFPTEQLCFLGLISM
IDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIANRLNIP
LSQVDPRDAKACVVHGSDLKDMSSEYLDDLLRNHTEIVFARTSPQQKLIIVEGCQRQGAI
VAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDN
LKKSIAYTLTSNIPEISPFLLFIIASVPLPLGTVTILCIDLGTDMVPAISLAYETAESDI
MKRQPRNPATDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPITLVGIRIDWD
AREVNDVEDTYGQQWTYEQRKIIEFTCHTSFFVSIVVVQWADLIICKTRRNSLFQQGMKN
RILIFGLFVETALAAFLSYCPGMDVALRMYPLKAMWWFCAFPYSLLIFIYDEVRKLILRI
SPGGWVEQETYY
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggggagagggtgtggtgccgagaatggagggaagaggaagaagaaggacagggatttg
gatgagctgaagaaggaagtggcctttgatgaccaccgaatccctctggacgatctgggg
aaacgctatggagtggagctcacacggggcttgaccaacgccagagctgtggagattctg
gccagggacggtccgaactccctgactcctccacccaccaccccggagtgggtcaagttc
tgccgtcagctgttcggcggcttctccgtcctgctctggatcggtgctaccctctgcttc
ctggcgtactgcatccaggtggccacggaggacgagccgcccaatgacaacctgtatctg
ggcgtggtgctggcggccgtggtgatcatcaccggctgcttctcctacttccaagaggcc
aagagctcccgcatcatggactccttcaagaaaatggtgcctcagcaagcgctggtgatc
cgggagggggagaagatgcagatcaatgctgagcttgtggtgcagggagatctggtggag
atcaaagggggagaccgcatcccagctgaccttcgagtgatctcctccagcggatgcaag
gtggacaactcctctctgacgggagagtcggagccccagactcgctccccagagttgacc
aacgacaatcctctggagacccgcaacatctgtttctactccaccaactgtgtcgagggt
acagcccacggcatcgtgatagccaccggtgaccggacggtgatggggcgcatcgccact
ctggcgtccgagctggaggtccgccagacgcccatcaatatcgagatcgaacacttcatc
cacatcatcacgggcgtggccgtcttcctgggagtgagcttcttcatcctgtccctcatc
ctgggctacacttggcttgaggccgtcatcttcctcatcggcatcatcgtggccaacgtg
cctgaaggcctgctggccaccgtcactgtgtgtctgactctcactgccaagcgaatggcc
aagaagaattgtctggtgaagaacctggaggccgtggagacgctcggctccacctccacc
atctgctccgacaagacgggcacgctgacccagaaccgcatgaccgtgtcccacatgtgg
tttgacaaccagatccacgaggccgacaccaccgaggaccagacaggtttgggttttgac
aagagctctgctacttggactgctctgtctcgtgtggccggcctgtgcaacagagcggat
ttcaaagctgcgcaggagcaccttcctctccagatggtattgacttccaccccacgcctc
tcggtccatgaagtggaggacaatccctccggtcatattctggtcatgaagggagcgccg
gagagaatcttggacaggtgcagcagcattatggtgcagggccaggagcagacgctcgat
gagaactggagggaagctttccagaacgcctacatggagctgggaggcctcggagagaga
gtgctcggcttctgccacttgaatctgtcttcggctcagttccctcgaggcttcaccttc
gactgcgatgacacgaactttcccaccgagcagctctgcttcctgggtctcatctccatg
attgatccgccgcgtgccgctgtgcctgacgcagtgggtaaatgccgctctgctggtatc
aaggtgatcatggtaaccggggaccacccaatcacagccaaggccatcgccaaaggtgtg
ggcatcatctctgagggcaacgagacagttgaagacatcgcaaatagactgaacatccct
ctgagtcaagttgaccccagggatgccaaggcctgcgtggtgcacggctcggacctgaag
gacatgagctctgagtacctggatgacctgctgaggaaccacactgagatagtgttcgct
cgcacctcccctcagcagaagctcatcatcgtcgagggctgccagagacagggggcgatc
gtggctgtgacaggagacggtgtgaacgactccccagccttgaagaaagccgacatcggc
gttgccatgggaatcgccggctctgatgtatccaagcaggcggctgacatgatcctgctg
gacgacaacttcgcttccattgtgacgggagtggaggagggtcgtctcatctttgataat
ttgaagaagtccattgcctacacgctgaccagtaacatcccagagatctcccccttcctc
ctcttcatcatcgccagtgttcctcttcctctgggaacagtgaccatcctctgcatcgac
ctcggcaccgacatggtcccagccatctcattggcttacgagacagccgagagcgacatc
atgaaacgccagccgaggaatcccgcaacggacaagctggtcaatgagcgtctcatcagc
atggcctacggacaaataggcatgatccaggctctgggaggatttttcacctactttgtg
attttggctgagaacggcttcctccccataaccttagtgggcattcgcattgactgggac
gcccgcgaggtcaatgacgtggaggatacttacggccagcagtggacttatgagcagagg
aagatcattgaattcacctgccacaccagcttcttcgtcagcatcgtggtcgtccagtgg
gctgatctgatcatctgcaagaccaggaggaactccctcttccagcagggcatgaagaac
aggatcctgatcttcggcctgtttgttgagacggctcttgctgccttcctgtcctactgc
ccgggaatggacgtcgccttacgcatgtaccccctgaaggcgatgtggtggttctgtgcc
ttcccatacagtctcctcatcttcatttatgatgaggtccgtaaattaattctgaggata
tcccctggaggttgggtggagcaggagacatattattaa

DBGET integrated database retrieval system