KEGG   Paralichthys olivaceus (Japanese flounder): 109641588
Entry
109641588         CDS       T06037                                 

Gene name
npepps
Definition
(RefSeq) puromycin-sensitive aminopeptidase
  KO
K08776  puromycin-sensitive aminopeptidase [EC:3.4.11.-]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109641588 (npepps)
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109641588 (npepps)
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109641588 (npepps)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 109641588
NCBI-ProteinID: XP_019961655
Position
Unknown
AA seq 873 aa
MPERRPFVRLPTDVYPVNYGLCLKPDLIDFTFEGRLEALVEVTQATNQIVMNCADIDIIT
ASFVPQGGEEINATGFNYQNEDEKVTLSFPSALQKGSGMLKIDFVGELNDKMKGFYRSKY
TTPAGDVRYAAVTQFEATDARRAFPCWDEPAIKATFDITLIVPKERVALSNMNVIDRKPF
PEDENLVEVKFATTPIMSTYLVAFVIGEYDYVESQSSDGITVRVYTPVGKAEQGKFAMEV
ATKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQ
WVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADY
TRALDLDALDSSHPIEVNVGHPSEVDEIFDAISYSKGASVIRMLHNYIGDEDFRKGMNAY
LLKFQHKNASTEDLWDCLEQASGKPIAAVMGSWTKQMGFPIIVVEQEQQGDDRILKLSQK
KFCASGPHTGEVCPNWMVPISICTSEDPTCTKLKVLLDRPETTVTVSGVAPDQWLKINPG
TVGFYRIQYSSVMLESLLPGIRDLSLQPVDRLGLQNDLFSLSRAGMISTVQVLKLMEAFI
NEPNYTVWSDLSCNLGVLSSLLSHTDFHEDIQEFIRDLFTPIGLELGWDSKPGEGHLGAL
LRGLVLGKLGKAGHKPTLEEARRRFKEHVEGRQVLPADLRSPVYLTVLKHGDSATLDTML
KLHKQADMQEEKNRIERVLGAISAPDLIQKVLSFALSEEVRPQDTVSVIGGVAGSSKQGR
KAAWKFVKDNWEELYNRYQGGFLISRLIKLTVDGFAIDKMAAEVKSFFESHPAPAAERTV
QQCCENILLNAAWLKRDTDDIQQYLLQRKAPPV
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgcccgagaggaggcccttcgtacggttaccaactgacgtctaccccgtcaactacggc
ttgtgtctgaagcccgacctgatcgacttcaccttcgaggggcggctggaggcgctggtg
gaggttacacaagccacaaatcagattgtgatgaactgtgctgacatcgacatcatcaca
gcttcctttgtacctcagggaggagaagaaatcaatgcgacgggattcaactatcaaaac
gaggatgaaaaagtcaccctatcatttcctagcgctctacagaaaggctccggcatgttg
aagatcgacttcgttggggagctgaatgacaaaatgaaaggattctatagaagtaaatat
acaacccctgctggagacgtccgctacgctgctgtcacacagtttgaggctacggacgct
cgcagagctttcccctgctgggacgagccagctatcaaagccaccttcgacatcactctg
atagttcccaaggagcgagtagccttgtcaaatatgaatgtcattgatcgaaagccattt
ccagaggatgaaaacctggtggaagtgaagtttgccaccacacccatcatgtccacgtac
cttgtagcttttgtcattggtgaatacgactatgtggagagccaatcatcagacggtata
acggtacgcgtctacacgcctgtggggaaggcagaacaagggaaatttgcgatggaggtt
gcgactaagaccttacctttctacaaagactacttcaatgttccttatccattgcctaaa
attgatctcatagctattgctgattttgctgccggtgccatggagaactggggccttgtt
acctacagggagacggcgctgctaatcgacccgaaaaactcctgctcgtcctccaggcag
tgggtggcgctggtggtcggacacgaactcgcccaccagtggtttggcaacttggtcacc
atggaatggtggacccatctgtggttaaatgaaggattcgcgtcctggattgagtatctg
tgtgtggaccactgcttccctgaatacgacatctggactcagttcgtctcagctgattac
actcgcgctctggatctggacgcgctggacagcagccatcccatagaggtgaacgtgggc
catccgtcggaagtagatgaaatatttgacgccatctcctacagcaaaggagcgtctgtg
atccgcatgttacacaactatattggagacgaggattttaggaaaggaatgaacgcttat
cttttgaagttccaacataaaaatgcatcgacagaggacctatgggactgtctggaacag
gccagtgggaaacccatcgctgcagtgatgggctcgtggaccaagcagatgggcttccct
attattgtggtggaacaggaacagcaaggcgacgaccgcatcctcaagttatctcagaag
aagttctgtgccagtggaccacatactggtgaggtttgccccaactggatggtccccatt
agtatttgtaccagcgaggacccgacatgcaccaagctcaaggttctgctggacagaccc
gagacgactgtcactgtgagcggcgtcgctccagaccagtggctcaagatcaacccgggc
accgtgggcttctatcgcattcagtacagctcagtcatgctggagagtctgctgccgggc
atcagagacctcagcctgcagcccgtggaccgactcggcctccagaacgacctcttctcc
ttgtctcgtgcagggatgatcagcacagtccaggtgctgaagctgatggaagcattcatc
aacgagccaaactacacagtgtggagcgacctcagctgcaacctgggagttctgtcgtcg
ctgctttcccacaccgacttccacgaggacatccaggagtttatccgggacctcttcacc
cccatcggcctcgagctcggctgggacagcaaaccaggagaaggtcacctgggtgccctg
ttgagaggcctggttctggggaagcttggaaaggcgggacacaaacccacactggaggag
gccagacggagattcaaggagcacgtggagggaagacaggtcctgcctgcagacctcagg
agcccggtgtatctaaccgtgctgaagcacggggacagtgccacgttggacacgatgctg
aagctccacaaacaggctgacatgcaagaggagaagaatcgcatcgagcgagtgctgggc
gccatctcagcccccgacctcattcagaaagtcctcagcttcgccctctcggaagaggtt
cgtccccaggacacagtgtcagtgatcggtggcgtcgcaggaagtagtaaacaaggccgg
aaagctgcctggaaatttgtcaaggacaactgggaggagctctacaatcgctaccagggc
ggcttcctcatatcacgactcataaagctcacggtcgacggcttcgctatcgacaaaatg
gctgctgaagtgaagagtttctttgagagtcacccggcgccggcggctgagcgtacagtg
cagcagtgctgcgagaacatcctcctcaacgccgcctggctgaagcgcgacacagacgac
atccaacagtatctactgcagcgcaaagccccccccgtctga

DBGET integrated database retrieval system