KEGG   Paralichthys olivaceus (Japanese flounder): 109641614Help
Entry
109641614         CDS       T06037                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00071  Fatty acid degradation
pov01212  Fatty acid metabolism
pov03320  PPAR signaling pathway
pov04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109641614
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109641614
   03320 PPAR signaling pathway
    109641614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pov03029]
    109641614
Enzymes [BR:pov01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     109641614
Mitochondrial biogenesis [BR:pov03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    109641614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf DUF3128
Motif
Other DBs
NCBI-GeneID: 109641614
NCBI-ProteinID: XP_019961687
Position
Unknown
AA seq 263 aa AA seqDB search
LSPPHQVQDQVHRSLAVAQVLADDVDCHVFPFKDFGKGRIKKLRVSPDAFIQISLQLAYF
RDRGGFCLTYEASMTRLFREGRTETVRSCSNESSDFVKALERGETEEQCRHLFRRASERH
QNLYRMAMTGAGIDRHLFCLYVVSKYLGVESPFLKEVLSEPWRLSTSQTPVQQMELFDLK
NHPDFVSLGGGFGPVADDGYGVSYIIVGEDMINFHVSSKYSFGGTDSHRFGAQISKALQD
VMILLTPDAKTSQSSKAQSKKVL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcccccccatcaggttcaggatcaggtgcacagatccctcgctgtggctcaagtg
ctcgcagatgacgtggactgtcacgtgttccccttcaaagacttcggcaaaggacgcatc
aagaagcttcgcgtcagcccggacgccttcatacagatcagcctccagctggcgtacttc
agggatcgtggtggtttctgtttgacctacgaggcgtcgatgacccgtctgttcagggag
ggccggacggagaccgttcgatcctgctccaacgaaagctctgactttgtgaaagctctg
gaacgtggagagacagaggaacagtgcaggcatctcttccgacgggcctcggagaggcac
cagaacctctatcgaatggccatgaccggagctggaatcgaccgacacctcttctgtctg
tacgtggtgtccaaatacctgggggtggagtcaccgttcctcaaagaggttttgtcggag
ccgtggcgtctctccaccagtcagaccccagttcagcagatggagctgtttgacctgaag
aaccatccggactttgtgtcgctgggcggagggttcggacctgttgctgatgatggttat
ggggtttcttacatcatcgttggcgaggatatgatcaacttccacgtgtcgtccaaatac
tccttcggtgggactgactcccacaggttcggcgctcagataagcaaagctctccaagac
gtcatgattcttctcacacccgacgccaaaacctcacagtcgtctaaagctcagtccaag
aaggtcctctga

DBGET integrated database retrieval system