KEGG   Paralichthys olivaceus (Japanese flounder): 109641656
Entry
109641656         CDS       T06037                                 

Gene name
lta4h
Definition
(RefSeq) leukotriene A-4 hydrolase
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00590  Arachidonic acid metabolism
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109641656 (lta4h)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109641656 (lta4h)
Enzymes [BR:pov01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     109641656 (lta4h)
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109641656 (lta4h)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C
Other DBs
NCBI-GeneID: 109641656
NCBI-ProteinID: XP_019961736
Position
Unknown
AA seq 446 aa
MSALRDGQEVDPQDNNRIIYRFRQPVAMPSYLIAIVVGDLESRVIGPRSRVWSEKEFVDK
AASEFSETEAMLITAEDLAGPYVWGQYDILVLPPSFPYGGMENPCLTFATPTLLAGDKSL
SNVIAHEISHSWTGNLVTNKTWEHFWLNEGHTVYLERMIGRRLEGEQFRQFKAMGGWKDL
QDSVNTFGVNNPLTNLVPSLQDVDPDDAFSSVPYEKGFALLYYLEELMGGPEEFMGFVKS
YIQLFAYSSVTTDDWKNYLFTYFKDKVDVLNKVDWNAWMFTPGMPPVKPQYDTTLADACI
ALSQRWIKAKDLNSFTENDLKTMSSHQLIEFLSLLLQEDPLPLTHLKKMQEVYDLNACLN
AEIRFRWLRLCVRSKWEEAVPMALKMATEQGRMKFTRPLFREVFNFEKFSDEAVRVFVAH
RAEMHSVTSGLVAKDLKVDVLKSTSL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgagtgcactgagagatggacaggaagttgatcctcaggacaacaatcgtatcatctac
aggttcagacagccggtggccatgccgtcctacctgatagcaatcgtggttggagatcta
gagagcagagtaattggtccaaggtctagagtgtggtcagagaaagagtttgttgataag
gcagcgtctgagttttctgagacggaggccatgttgattactgcggaggatctggctgga
ccatatgtttggggtcagtacgacatcctggttcttccaccatctttcccatacggagga
atggagaacccgtgtctgacctttgccactccgacactgctggctggagataaatctctg
tccaacgtgatcgctcatgagatctcgcacagctggaccgggaacctggtgaccaacaag
acctgggaacacttctggttgaacgagggtcacacggtgtacctggagaggatgattggc
aggcgtctggagggggaacagttccgacagtttaaggcgatgggcggctggaaggatctg
caggactctgtgaacacatttggggtcaacaaccctctcactaacttggttcccagtctc
caggacgtcgaccctgacgatgccttctcctctgttccttacgagaaaggctttgctctg
ctgtattacctggaggagctgatgggtggtccagaggaattcatgggctttgtaaagtcg
tacattcagctgttcgcctacagcagtgtgacgacagacgactggaagaactacctgttc
acatactttaaagacaaggttgacgtcctgaacaaggtggactggaatgcctggatgttc
actcctgggatgcctcctgtcaaacctcagtatgacaccacactggctgacgcctgcatt
gctctgagtcagaggtggatcaaggccaaagatctgaacagcttcacagagaacgacctg
aagacaatgtcgtctcatcagctgatcgagttcctgtctctcctgcttcaggaggatcct
cttcctctgactcacctgaagaagatgcaggaggtttatgatctgaacgcctgtttgaac
gcagagatccgcttcaggtggctgaggttgtgtgttcggtctaagtgggaggaggcggtt
cccatggcgctgaagatggcgacagaacagggcagaatgaagttcacaagaccgttgttc
agagaggtttttaactttgaaaagttcagcgatgaagccgtccgagtgtttgttgctcat
cgagcggagatgcactcggtcacttctggactcgtcgccaaagacctgaaggttgacgtc
ctgaaatccaccagtctgtaa

DBGET integrated database retrieval system