KEGG   Paralichthys olivaceus (Japanese flounder): 109642120Help
Entry
109642120         CDS       T06037                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00260  Glycine, serine and threonine metabolism
pov01100  Metabolic pathways
pov01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109642120
Enzymes [BR:pov01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     109642120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 109642120
NCBI-ProteinID: XP_019962348
Position
Unknown
AA seq 431 aa AA seqDB search
MSVKTLSCRLLFHSLKNTIVTSSKDQRARHAAAALPGRSSSSRGYYMTAKPRYPGPGGAP
DVRVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFGMEAALFVPT
GTMSNLIAVMVHCRERGDEMIVGDVSHIHIYEQGGSAQLAGVHATTVTTLPDGTFDLMQL
ESKIRHGYPDPHYPRTRLICVENTHNIQGGRVLPLTFLQEVRALADRYSLSVHMDGARVM
NAAVAQGVPPHAILQHTHTVSVCLSKGLGAPVGTMLAGPKDFIARALRCRKALGGGMRQA
GVLAAAGKLSLLDMVGRLEEDHRNAKTFAQALLDFDPLFAVDMAAVETNILRFYLKGLSL
SPVEFCAGMAQVGEGDKAALGQGVQVLMYPHFGNSVRAVWHLGISPEDTQLAIQKMRFVA
SQHLKKELKAQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgaaaactctcagctgcagactcttgtttcattcgttaaaaaacacgatcgtc
acttcaagtaaagaccagcgggcccgacatgctgcagctgctctgccgggacggagctcc
tcctcccggggatactacatgaccgcgaagcccaggtatcccgggccgggcggagcgccc
gacgtccgggtggtggacctccgcagcgacacggtgaccaagcccgggcccgcgatgcgt
caggccatggcggaggccgaggtcggagatgatgtgatgggagaggatcccacagttaac
gagctacaaaaaatcgcagcggatatgtttgggatggaggccgcgctcttcgtccccact
ggaaccatgagtaacctcatcgcagtgatggtgcactgtcgggagagaggcgacgagatg
attgtgggcgatgtgtcgcacatacacatctatgagcaaggaggcagtgcacagctggct
ggtgtccacgccaccacggtgaccacgctccccgatgggacatttgatttgatgcagctg
gaatcaaagatccgccacggttaccctgacccccactacccccgcacacgcctcatatgt
gtggagaacacacacaacatacaaggaggacgtgtgctgcctctgaccttcttgcaggag
gttcgtgcccttgcagacagatacagtctgtcggttcacatggacggagccagggtgatg
aacgctgctgtagcacagggggttcctccacacgccatcctgcagcacacacacactgtc
agtgtgtgcctctccaagggtttgggtgcccctgtgggtaccatgctggccggacccaaa
gacttcatcgccagagcgttgcggtgccgtaaagctctgggtggggggatgcggcaggcg
ggtgtactagcagcagctggaaaattgtctttactggatatggtgggacgactggaggag
gatcaccgcaacgcaaaaaccttcgctcaagctctgcttgactttgaccctctatttgct
gttgacatggcggccgtggagacaaacatcctgcgtttctatttgaaagggctgagttta
agtcccgttgagttctgtgccggcatggcccaggtcggcgagggagacaaggctgcattg
ggacaaggggtacaagttctaatgtaccctcattttggaaactcagtccgggctgtgtgg
catctcgggatctcccctgaagatacccagctggccatccagaaaatgcgatttgttgct
tctcagcacttgaagaaagaactcaaagcccagtga

DBGET integrated database retrieval system