KEGG   Paralichthys olivaceus (Japanese flounder): 109642212
Entry
109642212         CDS       T06037                                 

Gene name
dguok
Definition
(RefSeq) deoxyguanosine kinase, mitochondrial
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00230  Purine metabolism
pov00240  Pyrimidine metabolism
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109642212 (dguok)
   00240 Pyrimidine metabolism
    109642212 (dguok)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109642212 (dguok)
SSDB
Motif
Pfam: dNK AAA_17 AAA_18 Thymidylate_kin
Other DBs
NCBI-GeneID: 109642212
NCBI-ProteinID: XP_019962459
Position
Unknown
AA seq 180 aa
MLYDKPSRWSYTFQSYACLSRVRSQLQSPSIKLQQSEKPVQFYERSVYSDRYVFASNLFE
CGNLSDTEWSVYQDWHTWLLKQFTPEIHLDAIIYLRAQPQRCMQRLLQRGRGEEAGLPLE
YLEQLHFKHEAWLHHRSLRLDFDYLNDLPVLTLDVSDDFKNDRIKQEVIIDKVKDFLTTL
NT seq 543 nt   +upstreamnt  +downstreamnt
atgttgtacgataaaccaagccgctggtcctacaccttccagagttatgcgtgtctcagc
agagttcgttctcagcttcagtcgccgtcgatcaaacttcaacaaagtgaaaaacctgtt
cagttctacgagcgctctgtttactctgacaggtacgtgtttgcatcaaacctgtttgag
tgtgggaacctttcggacactgagtggagtgtttatcaggactggcacacctggttactg
aagcagttcacacctgagatccacctggacgccatcatctacctaagagcacagccacag
cgctgtatgcagcggttgctccagcggggccgtggggaggaggcgggactacctcttgag
tatctggagcagcttcacttcaaacatgaggcgtggcttcaccacaggagcctcaggttg
gactttgattatctgaacgatcttcctgttctgactctggatgttagcgacgatttcaag
aacgatcgaatcaaacaggaagtcatcatcgacaaggtcaaagacttcctcaccacgctg
tag

DBGET integrated database retrieval system