KEGG   Paralichthys olivaceus (Japanese flounder): 109642425Help
Entry
109642425         CDS       T06037                                 

Definition
(RefSeq) cAMP-responsive element modulator-like
  KO
K09052  cAMP response element modulator
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pov00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109642425
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pov03000]
    109642425
Transcription factors [BR:pov03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109642425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 ASD2 Chon_Sulph_att TMCO5
Motif
Other DBs
NCBI-GeneID: 109642425
NCBI-ProteinID: XP_019962772
Position
Unknown
AA seq 165 aa AA seqDB search
MSDCSYAERESREREKETERKEGERERGFSGAGIKSVFTLRCSAAVGLDYWKREMAVTGD
ETESAATGDIPAYQLRSPNSGLAQSIVMAASPGTMQSPSSQHAEEITRKREVRLMKNREA
ARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDIYCHKGE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactgctcgtatgcagagagagagagcagagagagggaaaaggagacggagaga
aaagagggagagagggagagaggtttcagtggagcaggaataaagagtgttttcacattg
aggtgttctgctgccgtggggctggattattggaaacgagagatggctgtaaccggggat
gagactgagtcagccgccacaggagacatccccgcctaccagctgcggtcgcccaactcg
ggcctggcgcaaagcatcgtgatggctgcgtccccgggcaccatgcagagcccgtcgtca
cagcacgccgaggagatcacccgcaagagggaagtcaggctgatgaaaaacagggaggca
gctcgtgagtgccgcaggaaaaagaaagagtacgtcaaatgtctggaaaaccgcgtggcc
gtgttagaaaaccaaaacaagaccctgattgaagagctgaaagcactgaaggacatttac
tgccacaaaggcgagtag

DBGET integrated database retrieval system