KEGG   Paralichthys olivaceus (Japanese flounder): 109642927Help
Entry
109642927         CDS       T06037                                 

Definition
(RefSeq) retinal guanylyl cyclase 2-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00230  Purine metabolism
pov01100  Metabolic pathways
pov04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109642927
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    109642927
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109642927
Enzymes [BR:pov01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     109642927
Protein kinases [BR:pov01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   109642927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 109642927
NCBI-ProteinID: XP_019963441
Position
Unknown
AA seq 1056 aa AA seqDB search
MWLPLWLLCVCVWLLSITEVWAATFKLALIGPWSCDPIFSRAMPTAAANLALSRLRSDSS
VSRGYWYDVKLLDEDCSTSKALTELGEMEGYGHAYIGPFNPALCHAASLLAQHWEVGLAS
PGCLDTNWLNLPPITPPSRVLFTVLRFFQWAHVGIISAPSNLWESTGQEVASALWAMGLP
TGPVVTMETRNKVGAREALKVIKEADKVKVVIMCMSSVLIGGEDQRELLLAALDMGMVSD
GYVFIPYDTLLYAMPYQETVFPQLTNSTQLRHAYSSVLTVTMASDQSFYEAFRQAQISRE
IRSGVAATEVSPVFGTIFNMVYFVAKAVEERRQAGGGHWVMGDHLFQSDGGFDFQGFNQV
LYGGKEGRGLQARYVVLDSDGDRLVPTHSLASTHTDGMVGGLRPLSRSFIFPGGKPPKAS
FCWFSPEETCSTGIDTVTMMFIFLLLCALIGAFFYWIRMYRRSANVTKLILTLDDIVFID
TQVSRKKLNDESIMRSLLDIKTPFHSIARSYLLTSPECSNIGILEGDWVWIKKIPAGKTM
TAVNQNTQSLFNHLREMRHENLNLYLGLFLDSGIFALIVEHCPRGSLADLLADATMRLDW
MFKSSLLMDLIKGMKFLHLRGLSHGRLKSTNCLVDGRFVLKITDYGLPMILHSQSLSLSE
DQQELLWSAPELLRNPVRGGSFAGDVFSFSIIIQEVISRTLPYAMMDMPAHEIVERLKMP
PPLFRPMVSVDEAPSECLSLMNECWNEDASKRPSFDDIFKQFRGINRGKRANIIDSMLRM
LEQYSSNLEDLIRERTDELEVERNKTEKLIGQLLPKSVAQALKKGKPVRPEHYSDSTLYF
SDIVGFTTISALSEPIEVVDLLNDLYTMFDAIIASHDVYKVETIGDAYMVASGVPNRNGI
RHAAEVANMSLDILHSIGAFKIKHMPEIKVKIRIGLHSGPVVAGVVGLTMPRYCLFGDTV
TTASHMEATGLPYRIHISLGTMKVLTSLKLGYHFDTRKAKVKGSEDTYWLIGQDGFTKPL
PVPPDLTGGASNHGISLDEIPVERRQKFLDRQKIKK
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgtggcttcctctgtggttgctatgtgtgtgtgtgtggttgctaagcatcacagaagtt
tgggcagctactttcaagctggctctgattggtccatggtcatgtgaccccatattctcc
cgggcaatgccaacggcagcagctaacctggcgctgtcacgattacggagcgacagtagc
gtgagcagagggtattggtacgatgtgaaactgcttgatgaagactgctccacttccaaa
gctctgacagaacttggagagatggagggttatggtcacgcctacattggaccatttaac
cccgccctctgtcatgcggcatccttattggctcagcactgggaggtggggcttgcctct
ccaggctgtctagatactaattggctgaacctgccgcccatcactcctcccagcagggtt
ctgtttaccgtgctcaggttcttccaatgggcacatgtggggattatctcagctccatcc
aatctatgggagagcactgggcaggaagtggcctcggcgctctgggctatgggcctcccg
actggcccagtggttaccatggaaacaaggaacaaagttggcgctcgggaggcactgaaa
gtgatcaaggaggccgacaaggtcaaagttgtgatcatgtgcatgagctctgttctgatt
ggtggagaggatcagagagagctcctattggctgctctggacatggggatggtttctgat
ggatatgtgtttataccatacgacactctcctgtacgccatgccgtaccaggaaacagtg
ttccctcagctgaccaacagcacgcagcttcgtcacgcctacagctccgttctgacggtt
actatggcgtctgaccagagtttctacgaagcttttcgtcaggctcaaatcagccgagaa
atccggtcaggagtcgctgcaacagaggtatctccagtgtttggaactatcttcaacatg
gtgtacttcgttgctaaggcggtggaggagcgtcgtcaggcaggaggtgggcactgggtg
atgggtgaccacctcttccaatcagatggaggctttgatttccaaggctttaatcaggtc
ttgtacggcggtaaagaggggcgtggcctgcaggccaggtacgtggtgttggatagcgat
ggcgaccgacttgtgccgacacattcgctcgcttcgacacacacagatgggatggtagga
ggtctgagacccctgagccgctcgttcatcttccccggaggaaaaccccccaaagccagt
ttctgttggttcagtccagaggagacgtgcagcactggaatcgacacagttacgatgatg
ttcatcttcctgttgctctgtgctctgattggagcatttttctactggatcaggatgtac
aggagatcagccaacgtcaccaaactgatcttgactctagacgacatcgtcttcattgac
actcaagtcagcaggaagaaactgaacgacgagtcgatcatgaggagtcttctggatatt
aaaactccattccactcgatcgctcgaagttaccttctgacgtcacctgagtgttccaac
atcggaatacttgagggcgactgggtttggattaagaagattcctgctggaaagacgatg
acagctgtcaatcaaaacacccagagtctgtttaaccatttacgggagatgagacatgag
aacctgaacttgtaccttggactctttctggactctgggatcttcgctctcattgtcgaa
cattgtcctcgaggaagtttggccgatctgctcgcagacgccaccatgaggctggactgg
atgttcaagtcctcgctgcttatggacctcatcaagggtatgaagtttcttcatcttcga
ggtttgagtcacggtcgactgaaatcgacaaactgtttagttgatggacgttttgttctg
aaaatcactgattacggacttcccatgatacttcactctcagagcctcagtctctctgag
gatcaacaagagctgctgtggtctgctccggagcttctgaggaatccggtccgtggaggt
tcgtttgccggagatgttttcagtttctccatcatcatacaggaagtgatctcacgcact
ctgccgtacgccatgatggacatgcctgcccacgagatcgtggagcgtctaaagatgccc
cctccactcttcagaccgatggtttcggtggacgaagctccgagcgaatgtctgagtctg
atgaacgaatgttggaatgaagatgcgagtaagagaccaagcttcgacgacattttcaaa
cagtttcggggcataaatcgcgggaagcgtgcgaacatcatcgactccatgttgcggatg
ttggagcagtacagttcaaacctggaggatttgatcagagaacgaacggacgaactggaa
gtcgagaggaacaaaacagagaaactgatcggacaacttctgccaaaatcagtggctcag
gctctgaaaaaagggaaaccagttcggcctgaacattattcagattcaactctttacttc
agtgacattgttggatttacaaccatctcagctctcagtgagccaattgaggtggttgac
ctcctgaatgacctctacaccatgtttgatgccattattgcaagtcatgacgtctacaag
gtggaaacgatcggagacgcctacatggtggcgtcaggtgtcccaaacagaaatggaatc
cggcatgctgctgaagtggccaacatgtctctggacatcctgcactccattggagctttt
aagatcaaacacatgcctgagatcaaagtgaagatacgcattggcctgcactcaggtccc
gttgtagctggtgtggttggactcacgatgcccagatattgtctgtttggtgacacagtg
accacagcatcacacatggaagccactgggctgccctacaggatccacatcagtctaggc
acgatgaaggttctgaccagcctcaaactgggatatcacttcgacaccaggaaagctaag
gtgaagggctcggaggacacctattggctaattggtcaagatggtttcactaaacctctt
cctgttcctccagacctgaccggaggggccagtaaccatggtatcagtctcgatgagatt
ccagttgagagacgtcaaaaatttctggaccgacagaagataaagaaataa

DBGET integrated database retrieval system