KEGG   Paralichthys olivaceus (Japanese flounder): 109643122Help
Entry
109643122         CDS       T06037                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109643122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pov04030]
    109643122
G protein-coupled receptors [BR:pov04030]
 Rhodopsin family
  Lipid
   Leukotriene
    109643122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa 7tm_4
Motif
Other DBs
NCBI-GeneID: 109643122
NCBI-ProteinID: XP_019963693
Position
Unknown
AA seq 374 aa AA seqDB search
MASNVTAAAATSAPLSVSAQVGIAILTLAFVLGFPGNLFVVWSVLCQVKKRSVTCLLVMN
LALADASVLLTAPLFLRYLAGGRGWEFGSVACKLVHYLSSVNMYVSIYLICLMSMDRWLA
VTQPFLSQRMRTKRSLLVLLLGVWVTAFILSLPMPFYRSNLKLKLQNNITASYCIPYHWK
SVGHQVFQYLFETFMACLVPFSLINTCYATVICRLRSAMFNRRGQGSRLILMIVCAFAVF
WLPYHIVNIVQVIGLLQKSDSVTGAALRARPSVTAFAYFSSAVNPVLYVFAGSSHIRKAG
LSFMGKLFDDTNSESRTTSTFSRSGRSRSSSSREETTALHTLSVKLGNTFKSKNKEKSGR
SAAKETLASVEQLE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaatgtcaccgccgccgctgccacctctgcgccgctcagcgtctcagctcag
gtcggcatcgccatcctgactctggcctttgtgctgggcttccccgggaacctgttcgtg
gtctggtccgtgttgtgccaggtgaagaagcgctcggtgacctgcttgttggtgatgaac
ctggctctggcggacgcgtccgtgctgctcaccgcgcctctcttcctgcggtacctggct
ggaggccgaggctgggagtttggctcagtggcatgtaagctggtgcactacctgtcgagt
gtcaacatgtacgtgtccatttacctcatctgcctgatgagcatggaccgctggctggct
gtcactcagccttttctgtcccagcgaatgaggaccaagcgctcgctgctggtcctcctg
ttgggggtctgggtgacggcgttcatcctgtcgctgccgatgcctttttatcgcagtaat
ctgaagctcaaactacagaacaacatcactgccagctattgcattccgtaccattggaaa
agcgtgggccaccaggtcttccagtacctgtttgagaccttcatggcctgcctggtgccc
ttctccctcatcaacacctgctacgccaccgtcatctgccgcctgcgcagcgccatgttc
aaccgcagaggacaaggcagccgcctcatcctgatgatcgtttgtgccttcgccgtgttc
tggctgccgtatcacatcgtcaacatcgtacaggtgattggcctgttgcagaaaagcgac
tcagtgaccggggctgcactcagagctcgacccagcgtcaccgccttcgcctacttcagc
agcgccgtcaaccccgtcctctacgtcttcgccggcagctcccacatccgcaaggccggc
ctgagcttcatgggcaaactgttcgacgacaccaactccgagagcaggaccacgtcgacc
ttttcccgcagcggccgcagccgcagcagcagctcccgggaggagaccaccgccctgcac
acgctgtcggtcaaactggggaacaccttcaaaagcaagaacaaggagaagagcggcagg
tcggcggcaaaggagacgctcgccagtgtggagcagctggagtag

DBGET integrated database retrieval system