KEGG   Paralichthys olivaceus (Japanese flounder): 109643424
Entry
109643424         CDS       T06037                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109643424
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109643424
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_3 Ank_4 Ank
Other DBs
NCBI-GeneID: 109643424
NCBI-ProteinID: XP_019964097
Position
Unknown
AA seq 370 aa
MLSVKAFDHLSQREHDLLQPLLMSSVVLVLFLLRLRSVEKSLLVIIALSLVFAQGLSALH
MACLYGQLGPLRVLVKTTLDELDSSDPQGRRPIHMVMSSQSSPKSAACLRFLLENGADIS
VTTDSGQTPLHHAAAAGLLDCVEILVQAGADVMAQDDMGHTPLDLARVWSHRDVGRYLRG
CVWLAEKKREMEERKQVRVLYRDLVAEAKLNELNKRILIDRKMNEWAAKKGLPNIKASSP
KVMVSQYHTKCLSSDHDTSNVGLRKLKPRPRESRPDLHDSVMVWTDSSGGGRPQYITKWE
SMPRYAPDVPLDILKRVLFPMASRIKSPQDFKARVIEEVTHRRCPQGTSRSPWTEVPEHL
VEVLEPGCER
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgttatcagtgaaggccttcgaccatttaagtcagcgagagcatgacttactgcagcca
ttgttaatgtcatcagttgtgcttgtgcttttcctgctcagactaagatctgtggagaaa
agcctattggtcattatcgccctctcactcgtctttgctcagggtctgtctgcgctccac
atggcctgcctttacggccagctgggtcctcttcgggtcctggtgaagaccacgttggac
gagctcgacagcagcgatcctcaggggcgccggcccatccacatggtcatgtcctcccag
agctcgcccaagtccgccgcctgtctcagattcctgctggagaacggagcagacatcagt
gtaaccacagactctgggcaaacaccgctgcaccacgcagctgccgcaggcctcctggac
tgcgtagagatcctcgtgcaggccggtgcagatgtgatggcccaggacgacatgggacac
acacctctggatttggctcgcgtctggtcccacagagacgtagggaggtatctgagaggc
tgcgtgtggctggcagagaagaagagagaaatggaggagaggaagcaagttcgggttcta
tacagggatcttgttgccgaggccaaactgaatgagctcaacaaaaggattcttatagac
aggaagatgaatgagtgggcggccaagaaaggtttacccaacatcaaggcttcctccccc
aaagtcatggtgagccagtaccacacaaagtgcctctcatccgatcacgatacatctaat
gtgggtctgaggaagctcaagccaaggccgagggaatccaggcctgacctccatgacagt
gtcatggtgtggacggacagcagtggcggggggcggcctcagtatatcaccaagtgggag
agcatgcctcgttacgcccctgacgtgcctttggacatcctcaagagggtgttgttcccc
atggcgtccaggatcaaatcccctcaggactttaaggcgcgggtcatcgaggaggtcacg
cacagaagatgcccccagggaacgagccgctcaccctggacggaggtgcccgagcacctg
gttgaggtgttggagcctggatgtgagcgctga

DBGET integrated database retrieval system