KEGG   Paralichthys olivaceus (Japanese flounder): 109643623
Entry
109643623         CDS       T06037                                 

Definition
(RefSeq) aminopeptidase N-like
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00480  Glutathione metabolism
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109643623
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109643623
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109643623
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109643623
   04090 CD molecules [BR:pov04090]
    109643623
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     109643623
Peptidases and inhibitors [BR:pov01002]
 Metallo peptidases
  Family M1
   109643623
Membrane trafficking [BR:pov04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    109643623
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   109643623
CD molecules [BR:pov04090]
 Proteins
  109643623
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 Peptidase_M1_N DUF1925
Other DBs
NCBI-GeneID: 109643623
NCBI-ProteinID: XP_019964347
Position
Unknown
AA seq 942 aa
MSWNSCKSKLLAGAFVVLTISIIAGMAIMIIFYQSQISAMNPTPRPTFAPTTTELPPEGR
LPRDLVPESYEVVLQPHFYTRIIEVENVTSPNQTSHFTGNSTVNFKCVQKTSSIFLHSKG
LEVSDSMVKNRDDVDEKIRSSVVYPGYSDFLEIQLNVALEAGGNYSLFLNFKGEMTDNLE
GLYLSTYSEGDSEEEGYMNTVRYLAATNMEPTSARRVFPCFDEPDMKAVFHVAIIHRKDT
FALANGEKIDTKPIENEWQRTRFNPTPRMSTYLFAIVVSEFTSASSPHHRADIKTFARPE
AITAGDAQYAANITGKILQFYEDYFGIDNPLKKLYQIALPDLNPAAMENWGLVTYQEGLL
LFEEGVSSFLHKETVASLIAHELAHQWFGNLVTMKWWNEIWLNEGFASYMTYFAMDAVEP
SFKMKDIIIMKDLQKAFAEDALASSHPLTPPQEEIQTTSEIMNMFDSITYSKGALLLRLL
ADIVGQNIFDQGVKKYLWDFSYKNTDQNDLWDHIQKVVDEDGGYTQVKVVMDKWTKQIGY
PVINIDTKSGEVYQKHFLFNDSSESSLWWYVPIRVMSNTSESSLIWLENNKTERIDQFIS
KNGEWILANVNCTGYYRVNYNLENWDVLLSQMEEDPERIPLMNRGQLIDDAFNLARAKLV
DVTLPLNLTRFLRNETEYLPWESAMTNLRYFVLMFDRTEVYGPMQTYLREQVTGLYNFFK
NYTDHSQVPKEHSSQYNQINAVSVACSNELQECVTMAKRMFAHWMTIGTNIIHPNLRRAI
YCQAMAAGGKAEWEFAWKKFQNSSDTSERDQLRIALSCTRKTWLLNRYLEYTLDPEKIRL
MEVGYIIELIAQNPAGQALAWNFIRANWEYVQDTGEYFLIEAVTRRFSTQFELEELQRFA
ADNDLTYMRETQVVEQIQINIQWVSEHKEKILQWFERETGLE
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgtcgtggaactcctgcaagtccaagctcctcgccggggcctttgtcgtcctgacgatc
tccatcatcgccggcatggccatcatgatcattttctaccagagtcagatctccgcgatg
aacccgacgccccgtccgaccttcgcgcccaccaccacggagctgccacctgaagggcgg
ctgccaagggacctcgtacctgagagctacgaggtcgtcctgcagcctcacttctacacc
cggatcatcgaggtggagaacgtcaccagtcccaaccagacgagccacttcaccggaaac
tccacggtcaacttcaagtgtgtccagaagacgagcagcatcttcctccacagcaaaggc
ctggaagtttctgactccatggtgaagaacagagacgacgtggatgagaagatacgttcc
tccgtggtgtatcctgggtactctgattttctggagatccagctgaatgtggcgttggag
gcaggaggaaactacagcttgtttctgaattttaagggagagatgacggacaatctggag
gggctgtacctcagcacgtattcagaaggtgactctgaggaggaaggttatatgaacaca
gtgagatatctcgccgccaccaacatggagccgacgtctgccaggagagtgtttccttgt
ttcgacgagccggatatgaaggccgtgtttcacgtcgccatcatccacaggaaagacacc
tttgctctggcaaacggtgaaaaaatagacaccaaacccatagaaaatgagtggcagcgc
actcgtttcaatccgacgccgaggatgtcaacgtacctgtttgccatcgtggtttcagag
ttcacgtcagcttcctccccacatcatcgagcggacattaaaacgtttgctcgtcccgag
gccatcacagcaggagacgctcaatatgcagccaacatcaccgggaagatactccagttc
tacgaggattactttggaattgacaacccgctgaaaaagctgtaccaaatcgctctgcca
gacttgaaccctgctgcgatggaaaactggggactggtcacgtaccaggagggacttctg
ctctttgaggagggggtgtcctcgtttctgcacaaggaaacggtcgcgtctctgattgca
catgaactagctcatcagtggtttggaaatctggtgacgatgaaatggtggaatgaaatt
tggctgaacgagggctttgccagctacatgacctactttgcaatggatgccgtcgagccg
tcattcaaaatgaaagacattattatcatgaaagacctgcagaaggcgttcgcggaggac
gctctggcctcatcacatcccctcactcctccgcaggaagaaatccagacaacttctgag
atcatgaacatgtttgattcaatcacctacagtaagggggcccttttgctgagattgctg
gcagacatcgtgggtcaaaacatttttgaccaaggagtcaaaaagtacctctgggacttc
agctataagaacactgaccagaatgacctgtgggatcatatacaaaaggtcgtagatgag
gatggtggttacacccaggttaaggtggtgatggacaaatggaccaaacaaattggctat
cccgtcatcaacatcgacacgaagagcggagaggtctaccagaagcacttcctgttcaat
gactcttctgaatcgagtctttggtggtacgtcccgatcagagtcatgtcaaacacatct
gaatcgtctctcatctggttggaaaacaacaaaacagaaaggatagaccagtttatttcc
aagaacggagagtggatcctggcaaatgtgaactgcactggatactacagagtcaattac
aacctggagaactgggacgtcctcctgagtcagatggaagaagacccagagcggatccca
ctgatgaaccgagggcagctcatcgatgatgcattcaacttggcaagggccaaacttgtc
gacgtgactctgcctctgaatttgacgagattcctccgcaatgagacggagtaccttccc
tgggagtcagccatgacgaacctgaggtactttgtcctgatgtttgaccgcaccgaggtg
tacggacccatgcagacgtacctgcgggaacaggtcacggggctgtacaacttcttcaag
aactacacggaccattcccaagtcccgaaggagcactcctcacaatacaaccagatcaac
gccgtgtcggtggcctgttccaatgaactccaggaatgtgtgacgatggctaaaaggatg
tttgcccattggatgacaatcggcaccaacataatccatcccaacctgcgcagagcgatc
tactgccaggccatggctgccggtgggaaagcagagtgggaatttgcctggaagaagttt
cagaactccagcgacacctcggagagggaccagctccgcatcgctctgtcctgcaccaga
aagacctggctgctcaacagatacctggagtacactttggaccctgagaagattcgtttg
atggaagttggttacatcatagaactcatcgcccagaatcccgcagggcaggcgctggcc
tggaactttatcagagcaaactgggagtatgtccaagacacgggtgaatactttttgatc
gaggccgtgaccaggaggttctccacgcagtttgaactggaggagctgcagcgctttgcg
gccgacaacgatctgacttacatgagggagacgcaggtcgtcgagcaaatccaaatcaac
atccagtgggtcagcgagcacaaagaaaagatactccagtggttcgaaagagaaacgggc
ttagagtga

DBGET integrated database retrieval system