KEGG   Paenibacillus sp. 32O-W: IJ21_20700Help
Entry
IJ21_20700        CDS       T04219                                 

Definition
(GenBank) peptidase ClpP
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
pow  Paenibacillus sp. 32O-W
Pathway
pow00770  Pantothenate and CoA biosynthesis
pow01100  Metabolic pathways
Module
pow_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pow00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    IJ21_20700
Enzymes [BR:pow01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     IJ21_20700
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     IJ21_20700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Shikimate_DH adh_short_C2
Motif
Other DBs
NCBI-ProteinID: ALS27467
UniProt: A0A0U2IPT3
Position
2295577..2296845
Genome map
AA seq 422 aa AA seqDB search
MLKGKTILLGVTGGIAAYKAAILCSRLVQAGADVRVIMTQSATKFITPLTLQTLSRHPVY
LDTFDEKDPSVVAHIDLADHADLIIVAPATANIIGKMANGLADDMLSTTLLAATSPIIVA
PAMNVHMYEHPAVVANIQTLASRGVRFVEPGTGQLACGYVAKGRLAEPEDIVAAAERLFR
QGELLAGRRVLVTAGGTVERLDPVRFLTNDSSGRMGFAIAEAARNMGAEVVLVAGRTEGM
PPAGVELVHARSAAEMLDAVVARFDEADIVVKAAAVADYRPAAASDRKIKKSGDTMTLEL
VKTTDILQELGARKTRQFLVGFAAETGDIEKYAMDKLQRKNCDLVVANNVAAEGAGFNVD
TNIVQIYDSSGLVADLPLMSKREAAERIMQLVAERLDGAGGSGANVQPAWKAADADRDGE
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggggaaaacgattctgctcggggtgacgggaggcattgcggcgtataaggcc
gccatcctgtgcagccggctggtgcaggcaggcgccgatgtgcgcgtcatcatgacgcag
tccgcgaccaaattcattacgccgctgacgttgcagacgctatcgcgccatcccgtctat
ctggacacgttcgacgagaaagacccgtcggtcgtcgcgcatatcgatctggcggaccac
gccgacctgatcatcgtcgcgcccgcgacggccaacatcatcggcaagatggcgaacgga
cttgccgacgatatgttgagcacgacgctgctcgcggcaacgtcgccgattatcgtcgcg
ccggcgatgaacgttcatatgtacgagcatcccgcagtcgtcgccaacattcagacgctc
gcttcccgcggcgtccgtttcgtcgagcccggtacgggacagctcgcctgcggctatgtc
gccaaagggaggctggccgagccggaggatatcgtggccgctgcggaaaggctgttccgg
caaggcgagctgctggccggcaggcgggtgctcgtcaccgcgggcggtacggtggagcgg
ctcgatccggtccgcttcctgacgaacgactcctccggccggatgggattcgccattgcc
gaagcggcccgcaacatgggcgccgaagtcgtgctcgtcgcaggacgtacggaaggcatg
ccgcctgcgggcgttgagctggtccatgccagatcggccgcggaaatgctggacgccgtc
gtcgcccgtttcgacgaagcggacatcgtcgtgaaagcggcggcggtggcggactaccgg
cctgccgcggcatcggaccggaagatcaagaagagcggcgatacgatgacgcttgagctg
gtgaagacgaccgacattttgcaggagctcggcgcgcggaaaacccgccagtttctcgtc
ggcttcgcggcggagacgggcgatatcgagaaatatgcgatggacaagctgcagcggaaa
aattgcgatcttgtcgtggcgaacaacgtcgcggcggaaggggcgggcttcaacgtcgat
acgaatatcgtgcaaatttatgatagtagcggacttgtggccgatctgccgctgatgagc
aagcgcgaggcggcggagcgcattatgcagcttgtcgccgaacggcttgacggcgccggc
ggcagcggtgcgaacgtccagccggcctggaaagccgcagacgcggacagggacggggag
cgccgatga

DBGET integrated database retrieval system