KEGG   Paenibacillus sp. 32O-W: IJ21_26840Help
Entry
IJ21_26840        CDS       T04219                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
pow  Paenibacillus sp. 32O-W
Pathway
pow00250  Alanine, aspartate and glutamate metabolism
pow00330  Arginine and proline metabolism
pow01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pow00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IJ21_26840
   00330 Arginine and proline metabolism
    IJ21_26840
Enzymes [BR:pow01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     IJ21_26840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALS28080
UniProt: A0A0U2MF07
Position
2972450..2973997
Genome map
AA seq 515 aa AA seqDB search
MKVPFANEPLTDFTEERNRLAFEAALRTVERQLGQTYPIRIGGKEIVTDNKIVSFDPAAK
ERIVGFVSQGDAGLAEEAIRTAERTFHTWKRYTPDERARYLYKAAAVMRRKKHEFSAWMV
YEAGKTWAEADADTAEAIDFMEFYGREMQRLGRPQPLTRIPDEDNELYYMPLGVGIVIPP
WNFPLAITVGTTTAAVVAGNTVVLKPASPTPVIAAKFAEVLREAGLPDGVVNFLPAPGGT
VGDFMVGHPLTRFISFTGSRDVGLRINERAAQTAPGQKWIKRVVAEMGGKDSIVVDRDCD
LDLAAETITASAFGFSGQKCSACSRAIVHEDVYDRVLEKVADRTSRLVVGDPAKWATNVG
PVIDEKAFRKIGEYIRVGRQEGRLVIGGGTGDPAGYFIEPTVFADVDPDARIAQEEIFGP
VVAFIKAASFDEALAYANNTEYGLTGAVISRNRDHLELARREFFAGNLYFNRKCTGALVG
VHPFGGFHMSGTDSKAGGRDYLLLFTQAKLVSEKW
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgccgtttgcaaacgagccgttgacggattttaccgaggagcggaaccgtctc
gccttcgaagccgcgcttcgaacggtggagcggcagctggggcaaacgtatccgatcagg
atcggcgggaaggagatcgtaacggacaataaaatcgtgtcgttcgatcccgccgcgaag
gagcggatcgtcggcttcgtgtcacaaggcgatgccggtctggcggaagaagcgatccgt
acggcggaacggacgttccatacatggaagcggtatacgccggacgagcgcgcccgctat
ttgtacaaagccgctgcggtcatgcgccgcaaaaagcacgaattctcggcctggatggtg
tacgaagcgggcaaaacatgggcggaggccgatgcggatacggccgaagcgatcgacttt
atggaattttacggacgcgagatgcagcgtctcggccggccgcagccgctcacccgcatt
cccgatgaagataacgagctgtactatatgccgctcggagtcggaatcgtcattccgccg
tggaattttccgcttgccatcaccgtcggcacgacgacggcggcggtcgtagcgggcaat
acggtcgttctgaagccggcgagcccgacgccggtcatcgccgccaaatttgcggaagtt
ttgcgggaggccggtcttcccgacggcgtcgtcaatttcctgccggctcctggcggaacg
gtcggcgattttatggtcgggcatccgctgacccgcttcatcagcttcaccggctcccgc
gacgtcggcttgcggatcaacgagcgcgcggcccaaaccgccccgggccagaaatggatc
aaacgggtcgttgcggaaatgggcggcaaagattcgatcgtcgtggaccgcgattgcgac
ctggaccttgccgccgaaaccattaccgcctcggcattcggtttttccggacaaaaatgc
tcggcctgctcgcgcgcaatcgtccacgaggacgtatacgatcgtgtgctggagaaagtg
gccgatcgcacaagccggctcgttgtcggcgacccggcgaaatgggcgacgaacgtcggt
ccggtcatcgacgagaaagcgtttcggaaaatcggggaatacatccgggtcggccgccag
gagggacggctcgtcatcggcggcggaaccggcgatccggccggttattttatcgaaccg
acggtttttgccgatgtggatccggacgcacggatcgcgcaggaagaaattttcggcccc
gtcgtcgctttcatcaaggcggcatcgttcgatgaggcgctggcgtatgcgaacaatacg
gaatatggcttgacgggcgccgtcatttcccgcaatcgcgatcatctggaacttgcccgc
cgcgaattttttgccggcaatctgtacttcaaccgcaaatgcacaggagctcttgtcggc
gtccacccgttcggcggtttccatatgtccggcaccgattcgaaagccggcggccgcgac
tatttgctgctgttcacccaggcgaagctcgtgtcggaaaaatggtag

DBGET integrated database retrieval system