KEGG   Paenibacillus sp. 32O-W: IJ21_33770Help
Entry
IJ21_33770        CDS       T04219                                 

Definition
(GenBank) thiamine biosynthesis protein ThiJ
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
pow  Paenibacillus sp. 32O-W
Brite
KEGG Orthology (KO) [BR:pow00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    IJ21_33770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pow01002]
    IJ21_33770
Enzymes [BR:pow01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     IJ21_33770
Peptidases [BR:pow01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   IJ21_33770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase ThiJ_like
Motif
Other DBs
NCBI-ProteinID: ALS28766
UniProt: A0A0U2WQQ5
Position
complement(3731157..3731738)
Genome map
AA seq 193 aa AA seqDB search
MRIGFVVFNGITFLDFIGFYDVVNRLNWFEETKGTTWDICGLSEEISDESGLTIKVNRIK
PDLSEYDLLFVPGGMGTRKLRFDEECISWLRQAGQVQYIVSVCTGSLLLGAAGFLENKKA
TTHPNAYELLEPYCKEVVKARIVRDGNVITAGGVSTSIDLALYIVELLVNKGAVEIIKKQ
IDYPYERQGMIEV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaggattggtttcgtcgtctttaacgggatcacgtttttagactttatcggtttttat
gatgttgtaaatcggttgaattggtttgaagaaacaaaaggaacgacgtgggatatttgc
ggactttcggaagaaatatccgatgaatcaggattaacgattaaagtcaaccggattaag
cccgacctgtctgaatatgatttattgtttgttccgggaggtatgggaacgcgaaaactt
cgcttcgatgaggaatgtatttcatggctgcggcaagccggtcaagtccaatacatcgtg
tccgtttgtaccggctcgctcttgctcggagctgccggttttttagagaacaagaaagca
accacccatcctaatgcttatgagctattagaaccgtattgcaaagaagtagtgaaagcc
cgaatcgttcgagatgggaacgtgataacggcgggaggcgtttcaacatccatcgacctc
gctttatatattgtcgaacttttggtaaacaaaggagcggttgagatcattaagaagcaa
atcgactatccctatgaaagacaagggatgattgaggtgtag

DBGET integrated database retrieval system