KEGG   Pandoraea oxalativorans: MB84_02630Help
Entry
MB84_02630        CDS       T03840                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
pox  Pandoraea oxalativorans
Pathway
pox00053  Ascorbate and aldarate metabolism
pox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    MB84_02630
Enzymes [BR:pox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     MB84_02630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 RmlD_sub_bind NAD_binding_10 Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: AKC68585
UniProt: A0A0E3Y8M1
Position
complement(5170250..5171074)
Genome map
AA seq 274 aa AA seqDB search
MSQTSGKPFRRLLLTGAAGNLGKQLRGKLAEWADIVRVSDIVPITDTAPHEESMQVDLAD
RAAVHALLEGVDALVHLGGVSVEAPFDDILQANILGLYNVYSAAQKQGVKRIIYASSNHA
VGFHPVTEVLDVDAPHRPDGMYGISKCFGEDLSRYYFDRFGLETVCLRIGSSFEQPKNPR
MMVTYLSYRDFIELVRCSLFTNRVGHAIVYGVSDNPTLWVDNTKAAFLGFRPQDSSAEFA
GLFPAKAPDPQMDDWTQRFQGGPFVLMGPMEPKA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagccagacttccggcaaacccttccgccgtcttctgctgactggcgctgcgggcaac
cttggcaaacaactgcgcggcaagctcgcagagtgggcggacatcgtgcgcgtgagcgac
atcgtgccgatcaccgacactgcgccgcacgaagagtcgatgcaggtcgacctcgccgac
cgtgcggccgtgcacgcgctgctcgaaggcgtcgatgcgctggtgcatctcggcggcgtg
tccgtcgaagcaccgttcgacgacatcctgcaagcgaacatcctcggtctgtacaacgtc
tacagcgccgcgcagaagcaaggcgtgaagcgcatcatctacgccagttcgaatcatgcc
gtcggtttccatcccgtgacggaagtgctcgacgtcgacgccccgcatcgtcccgacggc
atgtacggcatctcgaagtgcttcggtgaagacctctcgcgttactacttcgaccgcttc
ggcctcgagaccgtgtgtctgcgcattggctcgtcgttcgaacagccgaagaatccgcgc
atgatggtgacgtatctgagctaccgcgactttatcgaactcgtgcgttgctcgctgttc
acgaatcgtgtcggtcacgcgatcgtttacggcgtgtccgacaacccgacgctgtgggtc
gacaacaccaaggcggcgttcctcggtttccgtccccaggacagctcggccgagttcgcc
ggtctattcccggccaaagcgcccgatccgcaaatggacgactggacgcaacgcttccag
ggcggcccgttcgtgctgatggggccgatggagcccaaggcatga

DBGET integrated database retrieval system