KEGG   Pandoraea oxalativorans: MB84_10475Help
Entry
MB84_10475        CDS       T03840                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pox  Pandoraea oxalativorans
Pathway
pox00480  Glutathione metabolism
pox00590  Arachidonic acid metabolism
pox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pox00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    MB84_10475
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MB84_10475
Enzymes [BR:pox01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MB84_10475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AKC69818
UniProt: A0A0E3U6T5
Position
complement(1269795..1270340)
Genome map
AA seq 181 aa AA seqDB search
MSTNIETIAVNRNDGAAASLGDYAGKVRLVVNVASKCGLTPQYEGLERLYEDKRAAGLEV
LAFPANNFKGQEPGTDAEILDFCTTQYNVTFPLFAKISVLGDDRHPLYSALVDAKPEATG
EGPFRERLKGFGVERDNPADVLWNFEKFLIGRNGQVVARFSPDVKADDPRLVAAIDAELA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaatattgaaaccatcgccgtcaatcgcaacgacggcgccgccgcctcgctg
ggcgattacgcaggcaaggtgcgtctcgttgtgaacgtcgcatcgaagtgcggtctgacg
ccgcaatatgaaggactggagcgtctgtacgaagacaagcgcgccgcaggtctggaagta
ctggcgttccccgccaataacttcaagggacaggaaccgggcaccgatgccgagatcctc
gacttctgcaccacgcaatacaacgtcacgttcccgctgttcgcgaagatctcggtgctg
ggcgacgaccgccacccgctgtacagcgcactggtcgacgccaaaccggaagccaccggc
gaaggtccgttccgcgagcgtctgaagggcttcggtgtcgagcgcgacaaccccgccgac
gtgctgtggaacttcgagaagttcctgatcggccgcaacggtcaggtcgtggcccgcttc
tcgccggacgtcaaggccgacgacccgcgtctggtcgccgccatcgacgccgaactcgcg
aagtaa

DBGET integrated database retrieval system