KEGG   Pandoraea oxalativorans: MB84_18795Help
Entry
MB84_18795        CDS       T03840                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pox  Pandoraea oxalativorans
Pathway
pox00071  Fatty acid degradation
pox00072  Synthesis and degradation of ketone bodies
pox00280  Valine, leucine and isoleucine degradation
pox00310  Lysine degradation
pox00362  Benzoate degradation
pox00380  Tryptophan metabolism
pox00620  Pyruvate metabolism
pox00630  Glyoxylate and dicarboxylate metabolism
pox00640  Propanoate metabolism
pox00650  Butanoate metabolism
pox00900  Terpenoid backbone biosynthesis
pox01100  Metabolic pathways
pox01110  Biosynthesis of secondary metabolites
pox01120  Microbial metabolism in diverse environments
pox01130  Biosynthesis of antibiotics
pox01200  Carbon metabolism
pox01212  Fatty acid metabolism
pox02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MB84_18795
   00630 Glyoxylate and dicarboxylate metabolism
    MB84_18795
   00640 Propanoate metabolism
    MB84_18795
   00650 Butanoate metabolism
    MB84_18795
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MB84_18795
   00072 Synthesis and degradation of ketone bodies
    MB84_18795
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MB84_18795
   00310 Lysine degradation
    MB84_18795
   00380 Tryptophan metabolism
    MB84_18795
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MB84_18795
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MB84_18795
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MB84_18795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pox04147]
    MB84_18795
Enzymes [BR:pox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MB84_18795
Exosome [BR:pox04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MB84_18795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKC71079
UniProt: A0A0E3U7Q2
Position
complement(3210512..3211693)
Genome map
AA seq 393 aa AA seqDB search
MSDIVIVSAARTAVGKFGGSLAKVAAPDLGAIVIDEVLKRAKLKGEDISEVIMGQVLTAG
SGQNVARQASIKAGLPAMVPAMTINKVCGSGLKAVMLAANAITAGEADIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLIDTMIVDGLWDVYNQYHMGITAENVAKEYGITREMQDAFAA
ASQNKAEAAQKAGRFDAEIVPVSIPQRKGDPVVFNTDEFVRHGVTAESLAGLKPAFSKDG
TVTAANASGINDGAAAVVVMSAKRAEQLGLTPLARIVAYANAGVDPSVMGIGPVPASQRC
LARAGWKASDLDLMEINEAFAAQALAVNKQMGWDTSKINVNGGAIAIGHPIGASGCRILV
TLLHEMARRDARRGLASLCIGGGMGVALAVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatcgtgattgtgtcggctgcccgtacggcagtcggtaagtttggcggctcg
ctggccaaagtggccgcgccggatctgggggcgatcgtgatcgacgaagtcctcaagcgc
gcgaagctcaagggcgaggacatcagcgaagtcatcatgggtcaggtgctgaccgctggt
tcgggccagaacgtggcacgtcaggcgtcgatcaaggccggcctgcccgcgatggtcccc
gccatgaccatcaacaaggtgtgtggctcgggcctgaaggccgtgatgctcgccgccaac
gcgatcaccgccggtgaagccgatatcgtcgtggcaggcggtcaggaaaacatgagcgcc
gcgccgcacgtgctgccgggttcgcgcgacggattccgcatgggcgatgcgaagctgatc
gacacgatgatcgtcgatggcctgtgggacgtgtacaaccagtaccacatggggatcacc
gccgagaacgtggccaaggaatacggcattacgcgcgaaatgcaggacgccttcgctgcg
gcctcgcagaacaaggcggaagccgcgcaaaaggccggtcgtttcgacgccgaaatcgtg
ccggtctcgattccgcagcgcaagggcgatccggtcgtcttcaacaccgatgagttcgtg
cgtcacggcgtgacggcggagtcgctggccggtctgaagcccgccttctcgaaggacggc
acggtgacggccgccaatgcgtcgggtatcaacgatggcgcggctgccgtggtcgtgatg
tcggccaagcgtgccgagcaactggggctcacgccgctcgcgcgtatcgttgcgtacgcg
aacgcgggcgtcgatccgtcggtcatgggcattggcccggtgccggcatcgcagcgctgc
ctcgcccgtgcgggctggaaggcgagcgatctggacctgatggaaatcaacgaagccttc
gctgcgcaggcactggcggtgaacaagcagatgggctgggatacgtcgaagatcaacgtg
aacggcggcgccatcgccatcggtcacccgatcggtgcgtcgggctgccgtattctcgtc
acgctgctgcatgaaatggcgcgccgcgatgcccgtcgcggcctggcctcgctgtgtatc
ggcggtggcatgggtgtagcgctggcggtggagcgcgtctga

DBGET integrated database retrieval system