KEGG   Pandoraea oxalativorans: MB84_21635Help
Entry
MB84_21635        CDS       T03840                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pox  Pandoraea oxalativorans
Pathway
pox00970  Aminoacyl-tRNA biosynthesis
pox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pox00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MB84_21635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pox03029]
    MB84_21635
Enzymes [BR:pox01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MB84_21635
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MB84_21635
Mitochondrial biogenesis [BR:pox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MB84_21635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKC71503
UniProt: A0A0E3U8P6
Position
3869892..3871268
Genome map
AA seq 458 aa AA seqDB search
MSHDAIDLQRPLSDLAAALDAGRTTSRALTEQALARIADPAGQGSVVFTQVDAQAARDAA
DGLDALRRAGVRLSPLMGIPVSVKDLFDVAGQVTRAGSTVLADAAPATHDALAVARLRRA
GAVIVGRTNMTEFAFSGLGLNPHYGTPRSPWQREVGHIAGGSSSGAAASVADGMAAVGLG
TDTGGSIRIPAAFCGLTGFKPTASRTPRDGALPLSTTLDSIGPIGRSVDCCAWVDAILSD
NIPNETPAAPRDLRGMRFGVLTNFVLDGAEPVALAIYERALDTLAKAGATLVEFKFAPFD
TLPAINRFGFSPIEAYAWHRKLLAERAHGYDPRVLVRIRRGEPAGAADYIDLINARAALV
AAANPVWQSFDAVLCPTVPLTPPAIAPLEASDETFTATNALVLRNPTAINMIDGCAFSLP
CQGQGEAPIGLMVSGATADDARLFPVARAIEQALRPSR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgacgccatcgatctgcaacgtcccctgtccgacctcgccgccgcgctcgac
gctggccgcaccactagccgggccctcaccgagcaggcgctcgcccgcatcgccgatccg
gccggtcagggcagtgtcgtcttcacgcaggtcgacgcacaagccgcccgcgacgccgcc
gacggcctcgacgccctgcgtcgcgccggtgtccgtttgtcgccgctgatgggcattccc
gtctcggtgaaggacctgttcgatgtggcgggtcaggtcacgcgtgcaggctccacggtg
ctcgcggacgccgcccccgccacgcacgacgcactggccgtcgcgcgtctgcgccgggca
ggtgccgtgatcgtcggtcgcaccaacatgaccgaattcgccttctccggtctcggcctg
aatccgcattacggcacgccacgctcgccgtggcagcgtgaggtcggccacatcgccggt
ggatcgtcctcgggcgcggccgcttcggtggccgatggcatggccgccgtcggcctcggc
acggataccggcggttcgatccgtattccggccgcattctgtggtctgacgggcttcaag
ccgacggcatcgcgtacgccgcgcgacggcgcgctgccgctctcgaccacgctcgactcc
atcggccccatcggccgctcggtcgattgctgcgcgtgggtcgatgcgattctgtcggac
aacatccccaacgaaacaccggctgcgccgcgcgacctgcgcggcatgcgcttcggcgtc
ttgacgaatttcgtgctcgacggcgcagaacccgtcgcgctcgccatttacgagcgcgca
ctcgatacgctcgccaaggcgggggcaacgctcgtcgagttcaaattcgcaccgttcgac
accctgcccgccatcaatcgtttcggcttctcgcccatcgaggcctacgcatggcatcgc
aagctgctggccgagcgtgcgcacggctacgacccgcgcgtgctggtgcgcattcgtcgc
ggcgaaccggcaggcgcagccgactacatcgatctgatcaacgcccgcgccgcactcgtc
gcggcggcgaatcccgtgtggcaaagcttcgacgccgtgctgtgcccgaccgtgccgctc
acgccgccggccatcgcaccgctcgaagccagcgatgaaaccttcaccgccaccaacgcc
cttgtgctgcgcaatccgacggccatcaacatgatcgacggctgcgccttctccctgccg
tgccagggtcagggcgaagcccccataggcctgatggtcagcggcgccacagccgacgac
gcgcgcctgttcccggtcgcccgcgccatcgaacaggccctgcgcccgtcccgctga

DBGET integrated database retrieval system