KEGG   Pandoraea oxalativorans: MB84_24130Help
Entry
MB84_24130        CDS       T03840                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pox  Pandoraea oxalativorans
Pathway
pox00020  Citrate cycle (TCA cycle)
pox00480  Glutathione metabolism
pox01100  Metabolic pathways
pox01110  Biosynthesis of secondary metabolites
pox01120  Microbial metabolism in diverse environments
pox01200  Carbon metabolism
pox01210  2-Oxocarboxylic acid metabolism
pox01230  Biosynthesis of amino acids
Module
pox_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pox_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MB84_24130
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MB84_24130
Enzymes [BR:pox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MB84_24130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKC71880
UniProt: A0A0E3YGQ8
Position
complement(4441604..4442857)
Genome map
AA seq 417 aa AA seqDB search
MSYQHIKIPAGEKITVNKDFSLSVPDNPIIPYIEGDGTGVDITPVMLKVVDAAVEKAYGG
KRKISWMEIYAGEKSTRIYGPDVWLPDETLQVVKDYVVSIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVQYFKGVPSPVRQPEKINMVIFRENSEDIYAGIEWEAESAGAKKLIAFL
QNEMGVSKIRFPQTSGIGVKPVSREGTERLVRKAIQYAIDNNRDTVTLVHKGNIMKFTEG
AFRDWGYELAKKEFAATEIDGGPWCKVKNPKTGKEITIKDSIADAFLQQILLRPAEYDVI
ATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILS
AEMMLRHMGWTEAADRIIASMEKSILSKKVTYDFARLMEGATQVSCSGFGDVMIENM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatcagcacatcaagatccccgcaggcgagaagatcaccgtcaacaaggatttc
tccctgagcgtgccggacaatccgatcattccgtatatcgaaggtgacggcacgggcgtg
gacattacgccggtgatgctcaaggtcgtcgacgcggcggtggaaaaagcttatggcggc
aagcgcaagatcagttggatggagatctatgcgggcgagaagtcgacgcgcatctatggt
ccggacgtgtggttgcccgacgaaacgcttcaggtcgtgaaggattacgtcgtgtcgatc
aaggggccgttgacgacgccggtcggtggcggcattcgttcgctcaacgtggcgctgcgc
cagcaactcgatctgtacgtgtgtctgcgtccggtgcagtacttcaagggtgtgccgtcg
ccggtgcgtcagccggagaagatcaacatggtgatcttccgcgagaactcggaagacatc
tatgcgggcatcgaatgggaagccgaatcggcgggcgcgaagaagttgatcgcgttcttg
cagaacgagatgggcgtgagcaagattcgctttccgcagacgtcgggcattggtgtgaag
ccggtgtcgcgtgagggcaccgagcgtctggtgcgcaaggccattcagtacgcgatcgac
aataaccgcgacacggtgacgctcgtgcacaagggcaacatcatgaagttcaccgaaggc
gcgttccgcgactggggttatgaactcgcgaagaaagagtttgcagcgacggagatcgac
ggcggtccgtggtgcaaggtgaagaatccgaagacgggcaaggagatcaccatcaaggac
tcgattgcggacgccttcctgcagcagattctgctgcgtcccgccgagtacgacgtgatt
gccacgctgaatctgaatggcgattacgtttccgacgcactcgctgcgcaggtcggtggc
atcggtatcgcgccgggcgcaaacctgtccgattcggtcgcgatgttcgaagcgacgcac
ggcaccgcgccgaagtatgcgggcaaggactacgtgaatccgggctcggagattctgtcg
gcggagatgatgttgcgtcatatgggttggaccgaggctgcggaccgcatcatcgcgtcg
atggaaaaatcgattctgtcgaagaaggtgacgtacgactttgcccgcttgatggagggc
gctacgcaggtatcgtgctccggtttcggcgacgtgatgatcgagaacatgtaa

DBGET integrated database retrieval system