KEGG   Pandoraea oxalativorans: MB84_24495Help
Entry
MB84_24495        CDS       T03840                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pox  Pandoraea oxalativorans
Brite
KEGG Orthology (KO) [BR:pox00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MB84_24495
Enzymes [BR:pox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     MB84_24495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase CBP_CCPA
Motif
Other DBs
NCBI-ProteinID: AKC71934
UniProt: A0A0E3U8R1
Position
4523923..4524780
Genome map
AA seq 285 aa AA seqDB search
MTSPDTKSTAQPAPTGAPVRVAAAQMVSAPDVDRNLREAARLVAEAAHAGAELVLLPEYF
CYMGQRDTDKLALRETPGSGPIQDFLAETARRYGVWLIGGTLPLAAPEPERVLNTTLVFA
PDGAPAARYDKIHLFNFVKGEEAYDEARTIRPGDAVRTFEAPFGRVGLSVCYDLRFPELY
RAMGDCTLMVVPAAFTYTTGRAHWELLLRARAVENQCYVLASAQGGHHENGRRTWGHSML
IDPWGEIVAQREAEGAGVVVGEVDPARLAGVRQSLPAWRHRVLQG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccccgatacgaagtcaaccgcccagcccgccccgaccggcgcgcccgttcgc
gtggctgccgcgcaaatggtgagcgcgcccgacgtcgaccggaacctgcgtgaagccgcc
cgtctggtggccgaagcagcgcacgccggggccgaactggtgttgctgccggagtatttc
tgctacatgggccagcgcgacaccgacaagctggcactgcgcgaaacgccgggcagtggc
ccgattcaggactttctggcggaaacggcacgccgctacggtgtctggctgatcggcggc
acgctgccgctggccgcgccggagcccgaacgcgtgctcaacacgacgctggtcttcgca
ccggacggcgcccccgccgcgcggtacgacaagatccacctgttcaacttcgtcaaaggc
gaggaagcctacgacgaagcgcgcaccattcgtcccggcgacgccgtccgtacgtttgaa
gcgccgttcgggcgcgtaggcctgtcggtgtgctacgacctgcgttttcccgagttgtac
cgggcgatgggcgactgtacgctcatggtcgtacccgccgcctttacctacaccactggc
cgcgcgcactgggaattactactgcgcgcgcgggccgtcgagaaccaatgctacgtgctg
gcgtccgcgcagggcgggcaccacgagaacgggcggcgcacgtgggggcattccatgctg
atcgacccgtggggcgaaatcgtcgcccagcgcgaagccgaaggcgctggcgtggtcgtg
ggcgaggtcgatccggcccggctggccggcgttcgccagagtctgcccgcctggcgtcac
cgcgtgctgcagggctga

DBGET integrated database retrieval system