KEGG   Onion yellows phytoplasma OY-M: PAM_281Help
Entry
PAM_281           CDS       T00154                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
poy00010  Glycolysis / Gluconeogenesis
poy00030  Pentose phosphate pathway
poy00051  Fructose and mannose metabolism
poy00680  Methane metabolism
poy01100  Metabolic pathways
poy01110  Biosynthesis of secondary metabolites
poy01120  Microbial metabolism in diverse environments
poy01130  Biosynthesis of antibiotics
poy01200  Carbon metabolism
poy01230  Biosynthesis of amino acids
poy03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:poy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM_281 (pfkA)
   00030 Pentose phosphate pathway
    PAM_281 (pfkA)
   00051 Fructose and mannose metabolism
    PAM_281 (pfkA)
   00052 Galactose metabolism
    PAM_281 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PAM_281 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PAM_281 (pfkA)
Enzymes [BR:poy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAM_281 (pfkA)
Protein phosphatases and associated proteins [BR:poy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAM_281 (pfkA)
Messenger RNA biogenesis [BR:poy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PAM_281 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat DUF3866
Motif
Other DBs
NCBI-ProteinID: BAD04366
UniProt: Q6YQU2
Position
324839..325837
Genome map
AA seq 332 aa AA seqDB search
MKNENQKAKTKTKENKKIAVLTSGGDAPGMNAAIRALVFESAKQGFEVFGVKDGYLGLFN
NQIEILNPQTFPRVLNVSGTFLGTSRFLDFQNNLDVRKQCAQNLKTLGIDKLVVIGGDGS
YKGASKLHELGIKCVGLPATIDNDICATDFTIGFSTALNNIVDAIEKLRDTSVSHNRCSI
IEVMGRHKGDLALFGGLAAGADVIVTRENLLSQKTICQKIKSLRQANQRHAIVVVTEHIF
DVASLAKEVENYSGFETRAQVLGHIQRGGKPTAEDLVLAFRMGSYAVSLLQQNIFNCAVG
TCGLNLHYTTFGDLFEKTYEKNELFNVVAKLL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaaaaccaaaaagcaaaaacaaaaacaaaagaaaacaaaaaaattgctgtg
ttaacttcaggcggcgatgctcctggaatgaatgcagctattcgtgctttagtttttgaa
agcgctaaacaaggatttgaagttttcggcgtaaaagatggttatttaggactttttaat
aaccaaatcgaaatcttaaatcctcaaacatttcctcgtgttcttaatgtgtctggtact
tttttgggaacttctcgttttttagattttcaaaataatttagatgttcgcaagcaatgc
gcccaaaatttaaaaactttaggaattgataaattagttgtaattggtggtgatggttct
tataaaggagcatccaaattgcacgaacttggcatcaaatgcgtaggactgccagccacc
attgacaatgatatttgtgccactgattttactattggatttagcactgctctcaataat
attgtagatgccattgaaaaattgcgcgatacttctgtttctcacaaccgatgcagtatt
attgaagtgatgggacgccacaaaggggatttggctttatttggtggacttgctgcagga
gcagacgttattgttactcgcgaaaatcttttatcccaaaaaactatttgccaaaaaatt
aaatctttgcgccaagcaaaccaaagacatgctattgtagttgtcactgaacatattttt
gatgttgcaagtttagccaaagaggtagaaaattacagtggtttcgaaactagagcccaa
gttttaggacacattcaaagaggtggtaaaccaactgcagaagatctagtccttgctttt
agaatgggaagttatgccgtttctttattgcaacaaaacatttttaattgtgctgttggc
acttgcggacttaatttgcattacactacttttggtgatctttttgaaaaaacttatgaa
aaaaatgaattatttaatgtagtagctaaattgttgtaa

DBGET integrated database retrieval system