KEGG   Onion yellows phytoplasma OY-M: PAM_308
Entry
PAM_308           CDS       T00154                                 

Name
(GenBank) hypothetical protein
Organism
poy  Onion yellows phytoplasma OY-M
SSDB
Motif
Pfam: ECF_trnsprt ECF-ribofla_trS BioY TarH
Other DBs
NCBI-ProteinID: BAD04393
UniProt: Q6YQR5
Position
complement(353275..353958)
AA seq 227 aa
MLNNQKNVLRKIIAISFLLFLAFGLELLSRYTINATIPCNYAFFRIELIFIILIGYLFGP
KYGFWASLFYLLIHYVLEFSFMEVLLHHIHENHNHSHDHENEHASKALIFLYRFFLPYIV
CSFSGLFYQKNLNHLTKKTPIIITLVLISVVQIISSILFINLLQENFAKKTFLKWFIPSP
SYSWSLNLIYSFSSVIVSNTIIGALFYLINLRLKDNMEFLYGFSKEN
NT seq 684 nt   +upstreamnt  +downstreamnt
atgttaaataatcaaaaaaatgttttaagaaagatcattgccatttctttcttattattt
ttggcttttggcttggaacttctttctcgttatactattaatgcaacaatcccttgcaat
tatgctttttttcgcattgaattaatttttatcattttaataggttatctttttggacct
aaatacggattttgggctagtttattttatcttttaattcattatgttttggaattttct
tttatggaagtgttattacaccatatacacgaaaatcataatcacagtcatgaccacgaa
aacgaacatgcaagcaaagcccttattttcctttacagattttttcttccctatattgtc
tgctctttttcgggcttattttatcaaaaaaacttaaatcatctcaccaaaaaaacacct
attataataactttagtattaattagtgtagttcaaattatttcaagcattttatttatt
aatttattacaagaaaactttgccaaaaaaacttttttaaagtggttcatcccaagtcct
tcttattcttggtcgcttaatcttatttatagtttttcatcagttattgtaagtaatacc
atcataggagctttattttatttaattaatttacgtcttaaagataatatggaattttta
tatggtttttccaaggaaaattaa

DBGET integrated database retrieval system