KEGG   Komagataella phaffii: PAS_chr1-1_0172Help
Entry
PAS_chr1-1_0172   CDS       T01092                                 

Definition
(RefSeq) hypothetical protein
  KO
K03963  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
ppa  Komagataella phaffii
Pathway
ppa00190  Oxidative phosphorylation
ppa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    PAS_chr1-1_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDUF_B7 Cmc1
Motif
Other DBs
NCBI-GeneID: 8196676
NCBI-ProteinID: XP_002489818
UniProt: C4QWB4
Position
1:877062..877409
Genome map
AA seq 115 aa AA seqDB search
MSGEESAKDIGQLREGKLYPLNYSHSHTNETIKLTLIVSHEEMKQNKIPLAYRDRCARLL
VPLNKCRKEGWYMPWNCVQERHDYEQCQYLDFKRRVKELEEIKKQRDAADASADL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggaggagtcggcgaaggacattggccaattgagagagggaaaactttatcct
ttgaactattcacattcgcacaccaatgagaccattaaactaacattgatagtttcccat
gaggaaatgaaacagaacaagattcctcttgcctacagagacagatgtgccagactgttg
gttcctctcaacaagtgtaggaaggagggatggtatatgccttggaattgtgttcaagag
agacacgactacgaacaatgtcagtatctggatttcaagagaagggtcaaggaattggag
gagatcaagaaacagagagacgctgcggatgcctcagcagatctttga

DBGET integrated database retrieval system